Sequence in raw or FASTA format:
Homo sapiens solute carrier family 30, member 10 (SLC30A10), mRNA.
| RefSeq Version | NM_018713.2, 52351207 |
| Length | 2869 bp |
| Structure | linear |
| Update Date | 12-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens solute carrier family 30, member 10 (SLC30A10), mRNA. |
| Product | zinc transporter 10 |
| Comment | Summary: Zinc functions as a cofactor for numerous enzymes, nuclear factors, and hormones and as an intra- and intercellular signal ion. Members of the zinc transporter (ZNT)/SLC30 subfamily of the cation diffusion facilitator family, such as SLC30A10, permit cellular efflux of zinc (Seve et al., 2004 [PubMed 15154973]).[supplied by OMIM]. COMPLETENESS: complete on the 3' end. |
| RefSeq | NP_061183.2 |
| CDS | 212..1669 | Exon (1) | 1..851 | Exon (2) | 1..851 | Exon (3) | 852..929 | Exon (4) | 930..1169 | Exon (5) | 1170..2854 |
| Translation | MGRYSGKTCRLLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYI
ARRPTRGFSATYGYARAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVG
VLGLLVNVVGLLIFQDCAAWFACCLRGRSRRLQQRQQLAEGCVPGAFGGPQGAEDPRRAA
DPTAPGSDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRG
VLLHVMGDALGSVVVVITAIIFYVLPLKSEDPCNWQCYIDPSLTVLMVIIILSSAFPLIK
ETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLHIKYPKDRGYQ
DASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGAL
PLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVSLDSCLSDHGQSLNKTQEDQCYV
NRTHF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(158) | - | t, g | dbSNP:115645353 |
| complement(1027) | - | t, c | dbSNP:113370181 |
| 1118 | + | a, g | dbSNP:34097842 |
| complement(1144) | - | , t | dbSNP:35117074 |
| complement(1504) | - | t, g | dbSNP:79106013 |
| complement(1524) | - | t, c | dbSNP:113588126 |
| 1784 | + | c, g | dbSNP:2231736 |
| complement(2339) | - | g, a | dbSNP:12092481 |
| complement(2413) | - | c, a | dbSNP:2275707 |
| complement(2614) | - | g, a | dbSNP:115277486 |
| complement(2654..2655) | - | , g | dbSNP:35632429 |
| complement(2757) | - | t, c | dbSNP:2275706 |
| complement(2781..2782) | - | , aa | dbSNP:3831345 |
| complement(2789) | - | g, a | dbSNP:11810214 |
| complement(2790) | - | t, c | dbSNP:115551730 |
| complement(2796) | - | , g | dbSNP:59755757 |
| complement(2797) | - | , g | dbSNP:74590215 |
| Gene Symbol | SLC30A10 |
| Gene Synonym | DKFZp547M236; ZnT-10; ZNT10; ZNT8; ZRC1 |
| Chromosome | 1 |
| Locus Map | 1q41 |
| All Transcripts | NM_018713 |
| Title | Polymorphisms in mitochondrial genes and prostate cancer risk . |
| Author | Wang,L., McDonnell,S.K., Hebbring,S.J., Cunningham,J.M., St Sauver,J., Cerhan,J.R., Isaya,G., Schaid,D.J. and Thibodeau,S.N. |
| Journal | Cancer Epidemiol. Biomarkers Prev. 17 (12), 3558-3566 (2008) |
| Title | In silico identification and expression of SLC30 family genes: an expressed sequence tag data mining strategy for the characterization of zinc transporters' tissue expression . |
| Author | Seve,M., Chimienti,F., Devergnas,S. and Favier,A. |
| Journal | BMC Genomics 5 (1), 32 (2004) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |