• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier family 30, member 10 (SLC30A10), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_018713 Homo sapiens solute carrier family 30, member 10 (SLC30A10), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_018713.2, 52351207
Length 2869 bp
Structure linear
Update Date 24-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier family 30, member 10 (SLC30A10), transcript variant 1, mRNA.
Product zinc transporter 10
Comment

Summary: This gene is highly expressed in the liver and is inducible by manganese. Its protein product appears to be critical in maintaining manganese levels, and has higher specificity for manganese than zinc. Loss of function mutations appear to result in a pleomorphic phenotype, including dystonia and adult-onset parkinsonism. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Mar 2012].


Transcript Variant: This variant (1) is protein-coding.

RefSeq NP_061183.2
CDS 212..1669
Misc Feature(1)65..67
Misc Feature(2)239..1360
Misc Feature(3)239..1360
Misc Feature(4)242..304
Misc Feature(5)332..394
Misc Feature(6)455..517
Misc Feature(7)551..613
Misc Feature(8)944..1006
Misc Feature(9)1046..1108
Exon (1)1..851
Gene:SLC30A10
Gene Synonym:HMDPC; ZnT-10; ZNT10; ZNT8; ZRC1
Exon (2)852..929
Gene:SLC30A10
Gene Synonym:HMDPC; ZnT-10; ZNT10; ZNT8; ZRC1
Exon (3)930..1169
Gene:SLC30A10
Gene Synonym:HMDPC; ZnT-10; ZNT10; ZNT8; ZRC1
Exon (4)1170..2854
Gene:SLC30A10
Gene Synonym:HMDPC; ZnT-10; ZNT10; ZNT8; ZRC1
Translation MGRYSGKTCRLLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYI ARRPTRGFSATYGYARAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVG VLGLLVNVVGLLIFQDCAAWFACCLRGRSRRLQQRQQLAEGCVPGAFGGPQGAEDPRRAA DPTAPGSDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRG VLLHVMGDALGSVVVVITAIIFYVLPLKSEDPCNWQCYIDPSLTVLMVIIILSSAFPLIK ETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLHIKYPKDRGYQ DASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGAL PLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVSLDSCLSDHGQSLNKTQEDQCYV NRTHF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(58)-dbSNP:
complement(58)-g, adbSNP:191465330
complement(158)-t, gdbSNP:115645353
complement(193)-t, cdbSNP:199933401
complement(229)-g, adbSNP:377586814
complement(250)-g, adbSNP:146077535
complement(260)-g, cdbSNP:374053468
complement(307)-t, gdbSNP:138123249
complement(317)-t, cdbSNP:148361417
complement(339)-t, cdbSNP:371004421
complement(389)-t, gdbSNP:200960734
complement(405)-g, adbSNP:377636913
complement(475)-g, adbSNP:374519103
477+c, tdbSNP:281860284
complement(495)-g, adbSNP:188273166
complement(513)-g, adbSNP:377707490
525..533+, cccggcccgdbSNP:281860285
711+c, tdbSNP:281860286
718+, gdbSNP:281860287
complement(760)-t, cdbSNP:201861047
complement(781)-g, adbSNP:376912502
796+, gdbSNP:281860288
complement(815)-t, gdbSNP:373396119
complement(887)-dbSNP:
complement(887)-t, cdbSNP:199783843
complement(967)-dbSNP:
complement(967)-g, adbSNP:143340726
976..978+, ggtdbSNP:281860289
complement(1000)-g, adbSNP:138025172
complement(1026)-g, adbSNP:371800776
complement(1027)-t, cdbSNP:113370181
complement(1063)-g, adbSNP:201423706
complement(1110)-t, cdbSNP:376599710
1118+a, gdbSNP:34097842
1133+c, tdbSNP:281860290
complement(1144)-, tdbSNP:35117074
complement(1157)-t, cdbSNP:372264976
complement(1176)-dbSNP:
complement(1176)-t, cdbSNP:149301485
1257+c, tdbSNP:281860291
complement(1277)-t, cdbSNP:371719088
complement(1329)-t, gdbSNP:202111121
complement(1330)-t, cdbSNP:200960383
complement(1342)-g, adbSNP:375288113
complement(1393)-t, cdbSNP:370815252
1446+, adbSNP:281860292
complement(1461)-g, adbSNP:377640108
complement(1463)-g, cdbSNP:202169262
complement(1481)-g, adbSNP:375331656
complement(1499)-t, cdbSNP:141152174
complement(1504)-t, gdbSNP:79106013
complement(1506)-t, cdbSNP:144098238
complement(1514)-g, adbSNP:200248346
complement(1524)-t, cdbSNP:113588126
complement(1534)-t, adbSNP:371035965
complement(1542)-c, adbSNP:377534021
complement(1543)-g, adbSNP:372500708
complement(1558)-g, adbSNP:146096083
complement(1559)-t, cdbSNP:368970531
complement(1603)-g, adbSNP:375831772
complement(1609)-g, adbSNP:148517155
complement(1610)-t, cdbSNP:372826011
complement(1614)-t, cdbSNP:369343170
complement(1619)-t, gdbSNP:149443882
complement(1630)-c, adbSNP:373607434
complement(1648)-g, adbSNP:144010718
complement(1659)-g, adbSNP:138457091
complement(1660)-t, cdbSNP:148203711
complement(1700)-g, adbSNP:183253440
1784+c, gdbSNP:2231736
complement(1945)-g, adbSNP:138571819
complement(1945)-g, adbSNP:386495478
complement(2130)-t, cdbSNP:147167207
complement(2274)-g, adbSNP:190901276
complement(2309)-t, cdbSNP:186031382
complement(2339)-g, adbSNP:12092481
complement(2413)-c, adbSNP:2275707
complement(2516)-t, cdbSNP:143476893
complement(2593)-t, cdbSNP:377449256
complement(2614)-g, adbSNP:115277486
complement(2654..2655)-, gdbSNP:35632429
complement(2757)-t, cdbSNP:2275706
complement(2757)-t, cdbSNP:111172220
complement(2789)-g, adbSNP:11810214
complement(2790)-t, cdbSNP:115551730
complement(2797)-, gdbSNP:59755757
complement(2830)-g, adbSNP:180746790
Gene SymbolSLC30A10
Gene SynonymHMDPC; ZnT-10; ZNT10; ZNT8; ZRC1
Chromosome1
Locus Map1q41
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_018713 Homo sapiens solute carrier family 30, member 10 (SLC30A10), transcript variant 1, mRNA. On-demand TBD TBD
XM_006711437 PREDICTED: Homo sapiens solute carrier family 30, member 10 (SLC30A10), transcript variant X1, mRNA. On-demand $549.00 14
XM_006711438 PREDICTED: Homo sapiens solute carrier family 30, member 10 (SLC30A10), transcript variant X2, mRNA. On-demand $449.00 14
XM_006711439 PREDICTED: Homo sapiens solute carrier family 30, member 10 (SLC30A10), transcript variant X3, mRNA. On-demand $449.00 14
Title Inherited manganism .
Author Ribeiro RT, dos Santos-Neto D, Braga-Neto P and Barsottini OG.
Journal Clin Neurol Neurosurg 115 (8), 1536-1538 (2013)
Title Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits .
Author Randall JC, Winkler TW, Kutalik Z, Berndt SI, Jackson AU, Monda KL, Kilpelainen TO, Esko T, Magi R, Li S, Workalemahu T, Feitosa MF, Croteau-Chonka DC, Day FR, Fall T, Ferreira T, Gustafsson S, Locke AE, Mathieson I, Scherag A, Vedantam S, Wood AR, Liang L, Steinthorsdottir V, Thorleifsson G, Dermitzakis ET, Dimas AS, Karpe F, Min JL, Nicholson G, Clegg DJ, Person T, Krohn JP, Bauer S, Buechler C, Eisinger K, Bonnefond A, Froguel P, Hottenga JJ, Prokopenko I, Waite LL, Harris TB, Smith AV, Shuldiner AR, McArdle WL, Caulfield MJ, Munroe PB, Gronberg H, Chen YD, Li G, Beckmann JS, Johnson T, Thorsteinsdottir U, Teder-Laving M, Khaw KT, Wareham NJ, Zhao JH, Amin N, Oostra BA, Kraja AT, Province MA, Cupples LA, Heard-Costa NL, Kaprio J, Ripatti S, Surakka I, Collins FS, Saramies J, Tuomilehto J, Jula A, Salomaa V, Erdmann J, Hengstenberg C, Loley C, Schunkert H, Lamina C, Wichmann HE, Albrecht E, Gieger C, Hicks AA, Johansson A, Pramstaller PP, Kathiresan S, Speliotes EK, Penninx B, Hartikainen AL, Jarvelin MR, Gyllensten U, Boomsma DI, Campbell H, Wilson JF, Chanock SJ, Farrall M, Goel A, Medina-Gomez C, Rivadeneira F, Estrada K, Uitterlinden AG, Hofman A, Zillikens MC, den Heijer M, Kiemeney LA, Maschio A, Hall P, Tyrer J, Teumer A, Volzke H, Kovacs P, Tonjes A, Mangino M, Spector TD, Hayward C, Rudan I, Hall AS, Samani NJ, Attwood AP, Sambrook JG, Hung J, Palmer LJ, Lokki ML, Sinisalo J, Boucher G, Huikuri H, Lorentzon M, Ohlsson C, Eklund N, Eriksson JG, Barlassina C, Rivolta C, Nolte IM, Snieder H, Van der Klauw MM, Van Vliet-Ostaptchouk JV, Gejman PV, Shi J, Jacobs KB, Wang Z, Bakker SJ, Mateo Leach I, Navis G, van der Harst P, Martin NG, Medland SE, Montgomery GW, Yang J, Chasman DI, Ridker PM, Rose LM, Lehtimaki T, Raitakari O, Absher D, Iribarren C, Basart H, Hovingh KG, Hypponen E, Power C, Anderson D, Beilby JP, Hui J, Jolley J, Sager H, Bornstein SR, Schwarz PE, Kristiansson K, Perola M, Lindstrom J, Swift AJ, Uusitupa M, Atalay M, Lakka TA, Rauramaa R, Bolton JL, Fowkes G, Fraser RM, Price JF, Fischer K, Krjuta Kov K, Metspalu A, Mihailov E, Langenberg C, Luan J, Ong KK, Chines PS, Keinanen-Kiukaanniemi SM, Saaristo TE, Edkins S, Franks PW, Hallmans G, Shungin D, Morris AD, Palmer CN, Erbel R, Moebus S, Nothen MM, Pechlivanis S, Hveem K, Narisu N, Hamsten A, Humphries SE, Strawbridge RJ, Tremoli E, Grallert H, Thorand B, Illig T, Koenig W, Muller-Nurasyid M, Peters A, Boehm BO, Kleber ME, Marz W, Winkelmann BR, Kuusisto J, Laakso M, Arveiler D, Cesana G, Kuulasmaa K, Virtamo J, Yarnell JW, Kuh D, Wong A, Lind L, de Faire U, Gigante B, Magnusson PK, Pedersen NL, Dedoussis G, Dimitriou M, Kolovou G, Kanoni S, Stirrups K, Bonnycastle LL, Njolstad I, Wilsgaard T, Ganna A, Rehnberg E, Hingorani A, Kivimaki M, Kumari M, Assimes TL, Barroso I, Boehnke M, Borecki IB, Deloukas P, Fox CS, Frayling T, Groop LC, Haritunians T, Hunter D, Ingelsson E, Kaplan R, Mohlke KL, O'Connell JR, Schlessinger D, Strachan DP, Stefansson K, van Duijn CM, Abecasis GR, McCarthy MI, Hirschhorn JN, Qi L, Loos RJ, Lindgren CM, North KE and Heid IM.
Journal PLoS Genet. 9 (6), E1003500 (2013)
Title Altered expression of ZnT10 in Alzheimer's disease brain .
Author Bosomworth HJ, Adlard PA, Ford D and Valentine RA.
Journal PLoS ONE 8 (5), E65475 (2013)
Title Efflux function, tissue-specific expression and intracellular trafficking of the Zn transporter ZnT10 indicate roles in adult Zn homeostasis .
Author Bosomworth HJ, Thornton JK, Coneyworth LJ, Ford D and Valentine RA.
Journal Metallomics 4 (8), 771-779 (2012)
Title Syndrome of hepatic cirrhosis, dystonia, polycythemia, and hypermanganesemia caused by mutations in SLC30A10, a manganese transporter in man .
Author Tuschl K, Clayton PT, Gospe SM Jr, Gulab S, Ibrahim S, Singhi P, Aulakh R, Ribeiro RT, Barsottini OG, Zaki MS, Del Rosario ML, Dyack S, Price V, Rideout A, Gordon K, Wevers RA, Chong WK and Mills PB.
Journal Am. J. Hum. Genet. 90 (3), 457-466 (2012)
Title Mutations in SLC30A10 cause parkinsonism and dystonia with hypermanganesemia, polycythemia, and chronic liver disease .
Author Quadri M, Federico A, Zhao T, Breedveld GJ, Battisti C, Delnooz C, Severijnen LA, Di Toro Mammarella L, Mignarri A, Monti L, Sanna A, Lu P, Punzo F, Cossu G, Willemsen R, Rasi F, Oostra BA, van de Warrenburg BP and Bonifati V.
Journal Am. J. Hum. Genet. 90 (3), 467-477 (2012)
Title Polymorphisms in mitochondrial genes and prostate cancer risk .
Author Wang L, McDonnell SK, Hebbring SJ, Cunningham JM, St Sauver J, Cerhan JR, Isaya G, Schaid DJ and Thibodeau SN.
Journal Cancer Epidemiol. Biomarkers Prev. 17 (12), 3558-3566 (2008)
Title In silico identification and expression of SLC30 family genes: an expressed sequence tag data mining strategy for the characterization of zinc transporters' tissue expression .
Author Seve M, Chimienti F, Devergnas S and Favier A.
Journal BMC Genomics 5 (1), 32 (2004)
Title Dystonia/Parkinsonism, Hypermanganesemia, Polycythemia, and Chronic Liver Disease .
Author Tuschl,K., Clayton,P.T., Gospe,S.M. and Mills,P.B.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Dystonia Overview .
Author Klein,C., Marras,C. and Munchau,A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.