• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_019077 Homo sapiens UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7), mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_019077.2, 41282212
Length 2333 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7), mRNA.
Product UDP-glucuronosyltransferase 1-7 precursor
Comment

Summary: This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols. [provided by RefSeq, Jul 2008].

RefSeq NP_061950.2
CDS 1..1593
Misc Feature(1)76..1563
Misc Feature(2)82..1323
Misc Feature(3)order(103..105,109..111,115..117,595..597,604..609,
Misc Feature(4)order(103..105,916..918,1105..1107,1111..1113,1117..1122)
Misc Feature(5)109..111
Misc Feature(6)1462..1512
Exon (1)856..987
Gene:UGT1A7
Gene Synonym:UDPGT; UDPGT 1-7; UGT-1G; UGT1-07; UGT1.7; UGT1G
Exon (2)988..1075
Gene:UGT1A7
Gene Synonym:UDPGT; UDPGT 1-7; UGT-1G; UGT1-07; UGT1.7; UGT1G
Exon (3)1076..1295
Gene:UGT1A7
Gene Synonym:UDPGT; UDPGT 1-7; UGT-1G; UGT1-07; UGT1.7; UGT1G
Exon (4)1296..2333
Gene:UGT1A7
Gene Synonym:UDPGT; UDPGT 1-7; UGT-1G; UGT1-07; UGT1.7; UGT1G
Translation MARAGWTGLLPLYVCLLLTCGFAKAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMP EVSWQLGRSLNCTVKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLF FSNCRSLFNDRKLVEYLKESCFDAVFLDPFDACGLIVAKYFSLPSVVFARGIFCHYLEEG AQCPAPLSYVPRLLLGFSDAMTFKERVWNHIMHLEEHLFCPYFFKNVLEIASEILQTPVT AYDLYSHTSIWLLRTDFVLEYPKPVMPNMIFIGGINCHQGKPVPMEFEAYINASGEHGIV VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
33+dbSNP:
33+a, cdbSNP:7577677
94+c, tdbSNP:145424374
101+a, tdbSNP:201684360
114+a, gdbSNP:200190624
144+c, tdbSNP:140853286
168+c, gdbSNP:7577789
198+g, tdbSNP:201856078
238+g, tdbSNP:145733073
243+a, cdbSNP:149618508
262+c, tdbSNP:151080578
267+a, gdbSNP:72551331
274+a, gdbSNP:45437497
282+c, tdbSNP:150285310
299+c, tdbSNP:182095678
306+a, gdbSNP:200147039
322+c, gdbSNP:201200762
339+c, tdbSNP:149528133
343+a, gdbSNP:61261057
352+g, tdbSNP:140814031
386+a, gdbSNP:56385016
387..392+ggacaa, tgaccgdbSNP:71405712
387+g, tdbSNP:17868323
391..392+aa, cgdbSNP:66534818
391+a, cdbSNP:17863778
392+a, gdbSNP:17868324
417+c, gdbSNP:114052958
422+c, gdbSNP:72551332
429+c, tdbSNP:183302274
467+c, tdbSNP:140683946
477+a, gdbSNP:139969318
514+a, gdbSNP:188337732
531+a, tdbSNP:28946878
534+a, gdbSNP:201980156
543+a, cdbSNP:200477397
602+c, tdbSNP:138921290
612+a, gdbSNP:147392032
622+c, tdbSNP:11692021
634+a, gdbSNP:193199170
660+c, tdbSNP:45462096
694+a, tdbSNP:28969713
702+c, tdbSNP:200299318
712+c, tdbSNP:141296723
729+c, tdbSNP:140179150
756+a, gdbSNP:17864686
757+g, tdbSNP:71423608
759+c, gdbSNP:201654358
760+c, tdbSNP:201879946
761+a, gdbSNP:144940363
769+g, tdbSNP:200834770
782+a, gdbSNP:149070815
828+a, cdbSNP:141393523
831+c, tdbSNP:200244233
854+c, tdbSNP:147013594
872+dbSNP:
872+c, tdbSNP:72551347
914+a, gdbSNP:62625011
940+a, gdbSNP:114000345
955+a, gdbSNP:200903749
956+c, tdbSNP:17851756
977+c, tdbSNP:202035422
982+c, tdbSNP:111033539
983+a, gdbSNP:72551348
997+dbSNP:
997+c, tdbSNP:139607673
1012+c, tdbSNP:72551349
1019+c, tdbSNP:144978321
1023+a, tdbSNP:149750520
1028+c, tdbSNP:201372184
1060+c, tdbSNP:72551350
1061+a, gdbSNP:72551351
1082+dbSNP:
1082+c, tdbSNP:34946978
1090+c, gdbSNP:55750087
1093+a, gdbSNP:72551352
1113+c, tdbSNP:139698110
1115+c, tdbSNP:72551353
1134+c, gdbSNP:72551354
1147+a, gdbSNP:143573365
1189+a, c, gdbSNP:28934877
1192+c, gdbSNP:72551355
1199+a, gdbSNP:140613392
1200+c, tdbSNP:114941320
1222+g, tdbSNP:36076514
1270+c, tdbSNP:11682453
1273+a, gdbSNP:72551356
1300+dbSNP:
1300+a, tdbSNP:72551357
1313+c, tdbSNP:202172337
1315+c, tdbSNP:143033456
1339+c, tdbSNP:201427749
1340+a, g, tdbSNP:200370335
1343+c, tdbSNP:114982090
1369+c, tdbSNP:115410088
1379+a, cdbSNP:72551358
1380+c, gdbSNP:115944950
1411+a, cdbSNP:72551359
1415+a, gdbSNP:150687296
1419+c, tdbSNP:28900406
1443+c, tdbSNP:147132183
1447+a, g, tdbSNP:34993780
1449+c, tdbSNP:142077822
1454+c, g, tdbSNP:72551360
1461+c, tdbSNP:114123636
1478+a, tdbSNP:72551361
1482+c, tdbSNP:199539868
1486+a, gdbSNP:199723856
1509+a, cdbSNP:190427553
1522+c, gdbSNP:1042709
1533+g, tdbSNP:200144439
1596+a, gdbSNP:1042710
1640+c, tdbSNP:34895241
1668+a, tdbSNP:182019761
1677+c, tdbSNP:78684540
1781+g, tdbSNP:200041554
1804+c, tdbSNP:10929303
1846+c, tdbSNP:61757316
1932+c, gdbSNP:1042640
1938+c, tdbSNP:112908387
2012+c, tdbSNP:34942353
2032+c, tdbSNP:138626513
2033+c, gdbSNP:8330
2042+, adbSNP:61757317
2054+g, tdbSNP:142810023
2263+g, tdbSNP:71539604
2285+c, tdbSNP:148128252
Gene SymbolUGT1A7
Gene SynonymUDPGT; UDPGT 1-7; UGT-1G; UGT1-07; UGT1.7; UGT1G
Chromosome2
Locus Map2q37
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_019077 Homo sapiens UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7), mRNA. On-demand $699.00 18
Title The association between UGT1A7 polymorphism and cancer risk: a meta-analysis .
Author Han,S.X., Wang,L. and Wu,D.Q.
Journal Cancer Epidemiol 36 (4), E201-E206 (2012)
Title UGT1A1 is a major locus influencing bilirubin levels in African Americans .
Author Chen,G., Ramos,E., Adeyemo,A., Shriner,D., Zhou,J., Doumatey,A.P., Huang,H., Erdos,M.R., Gerry,N.P., Herbert,A., Bentley,A.R., Xu,H., Charles,B.A., Christman,M.F. and Rotimi,C.N.
Journal Eur. J. Hum. Genet. 20 (4), 463-468 (2012)
Title Association between polymorphisms in UDP-glucuronosyltransferase 1A6 and 1A7 and colorectal cancer risk .
Author Osawa,K., Nakarai,C., Akiyama,M., Hashimoto,R., Tsutou,A., Takahashi,J., Takaoka,Y., Kawamura,S., Shimada,E., Tanaka,K., Kozuka,M., Yamamoto,M. and Kido,Y.
Journal Asian Pac. J. Cancer Prev. 13 (5), 2311-2314 (2012)
Title A genome-wide association study of total bilirubin and cholelithiasis risk in sickle cell anemia .
Author Milton,J.N., Sebastiani,P., Solovieff,N., Hartley,S.W., Bhatnagar,P., Arking,D.E., Dworkis,D.A., Casella,J.F., Barron-Casella,E., Bean,C.J., Hooper,W.C., DeBaun,M.R., Garrett,M.E., Soldano,K., Telen,M.J., Ashley-Koch,A., Gladwin,M.T., Baldwin,C.T., Steinberg,M.H. and Klings,E.S.
Journal PLoS ONE 7 (4), E34741 (2012)
Title A genome-wide association study identifies UGT1A1 as a regulator of serum cell-free DNA in young adults: The Cardiovascular Risk in Young Finns Study .
Author Jylhava,J., Lyytikainen,L.P., Kahonen,M., Hutri-Kahonen,N., Kettunen,J., Viikari,J., Raitakari,O.T., Lehtimaki,T. and Hurme,M.
Journal PLoS ONE 7 (4), E35426 (2012)
Title Structural heterogeneity at the UDP-glucuronosyltransferase 1 locus: functional consequences of three novel missense mutations in the human UGT1A7 gene .
Author Guillemette,C., Ritter,J.K., Auyeung,D.J., Kessler,F.K. and Housman,D.E.
Journal Pharmacogenetics 10 (7), 629-644 (2000)
Title Human UDP-glucuronosyltransferases: metabolism, expression, and disease .
Author Tukey,R.H. and Strassburg,C.P.
Journal Annu. Rev. Pharmacol. Toxicol. 40, 581-616 (2000)
Title The UDP glycosyltransferase gene superfamily: recommended nomenclature update based on evolutionary divergence .
Author Mackenzie,P.I., Owens,I.S., Burchell,B., Bock,K.W., Bairoch,A., Belanger,A., Fournel-Gigleux,S., Green,M., Hum,D.W., Iyanagi,T., Lancet,D., Louisot,P., Magdalou,J., Chowdhury,J.R., Ritter,J.K., Schachter,H., Tephly,T.R., Tipton,K.F. and Nebert,D.W.
Journal Pharmacogenetics 7 (4), 255-269 (1997)
Title Differential expression of the UGT1A locus in human liver, biliary, and gastric tissue: identification of UGT1A7 and UGT1A10 transcripts in extrahepatic tissue .
Author Strassburg,C.P., Oldhafer,K., Manns,M.P. and Tukey,R.H.
Journal Mol. Pharmacol. 52 (2), 212-220 (1997)
Title Assignment of the human UDP glucuronosyltransferase gene (UGT1A1) to chromosome region 2q37 .
Author van Es,H.H., Bout,A., Liu,J., Anderson,L., Duncan,A.M., Bosma,P., Oude Elferink,R., Jansen,P.L., Chowdhury,J.R. and Schurr,E.
Journal Cytogenet. Cell Genet. 63 (2), 114-116 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.