• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu24768 Homo sapiens UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu24768C Homo sapiens UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_019077.2, 41282212
Length 1593 bp
Structure linear
Update Date 17-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens UDP glucuronosyltransferase 1 family, polypeptide A7 (UGT1A7), mRNA.
Product UDP-glucuronosyltransferase 1-7 precursor
Comment

Summary: This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols. [provided by RefSeq, Jul 2008].

RefSeq NP_061950.2
CDS 1..1593
Misc Feature(1)76..1563
Misc Feature(2)82..1323
Misc Feature(3)order(103..105,109..111,115..117,595..597,604..609,
Misc Feature(4)order(103..105,916..918,1105..1107,1111..1113,1117..1122)
Misc Feature(5)109..111
Misc Feature(6)1462..1512
Exon (1)856..987
Gene:UGT1A7
Gene Synonym:UDPGT; UDPGT 1-7; UGT-1G; UGT1-07; UGT1.7; UGT1G
Exon (2)988..1075
Gene:UGT1A7
Gene Synonym:UDPGT; UDPGT 1-7; UGT-1G; UGT1-07; UGT1.7; UGT1G
Exon (3)1076..1295
Gene:UGT1A7
Gene Synonym:UDPGT; UDPGT 1-7; UGT-1G; UGT1-07; UGT1.7; UGT1G
Exon (4)1296..2333
Gene:UGT1A7
Gene Synonym:UDPGT; UDPGT 1-7; UGT-1G; UGT1-07; UGT1.7; UGT1G
Translation MARAGWTGLLPLYVCLLLTCGFAKAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMP EVSWQLGRSLNCTVKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLF FSNCRSLFNDRKLVEYLKESCFDAVFLDPFDACGLIVAKYFSLPSVVFARGIFCHYLEEG AQCPAPLSYVPRLLLGFSDAMTFKERVWNHIMHLEEHLFCPYFFKNVLEIASEILQTPVT AYDLYSHTSIWLLRTDFVLEYPKPVMPNMIFIGGINCHQGKPVPMEFEAYINASGEHGIV VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
33+dbSNP:
33+a, cdbSNP:7577677
94+c, tdbSNP:145424374
101+a, tdbSNP:201684360
108+c, tdbSNP:376446155
114+a, gdbSNP:200190624
123+a, gdbSNP:373408916
144+c, tdbSNP:140853286
154+a, gdbSNP:377066301
168+c, gdbSNP:7577789
195+a, gdbSNP:370145562
198+g, tdbSNP:201856078
227+c, tdbSNP:374860015
238+g, tdbSNP:145733073
239+c, gdbSNP:367893933
243+a, cdbSNP:149618508
262+c, tdbSNP:151080578
267+a, gdbSNP:72551331
274+a, gdbSNP:45437497
282+c, tdbSNP:150285310
299+c, tdbSNP:182095678
306+a, gdbSNP:200147039
322+c, gdbSNP:201200762
339+c, tdbSNP:149528133
343+a, gdbSNP:61261057
352+g, tdbSNP:140814031
386+a, gdbSNP:56385016
387..392+ggacaa, tgaccgdbSNP:71405712
387+g, tdbSNP:17868323
391..392+aa, cgdbSNP:386656364
391..392+a, c, gdbSNP:397726009
391+a, cdbSNP:17863778
392+aa, cgdbSNP:66534818
392+a, gdbSNP:17868324
392+a, gdbSNP:78725335
417+c, gdbSNP:114052958
422+c, gdbSNP:72551332
429+c, tdbSNP:183302274
435+a, gdbSNP:375461567
446+c, tdbSNP:368625224
467+c, tdbSNP:140683946
477+a, gdbSNP:139969318
514+a, gdbSNP:188337732
531+a, tdbSNP:28946878
534+a, gdbSNP:201980156
543+a, cdbSNP:200477397
577+a, cdbSNP:368267055
602+c, tdbSNP:138921290
612+a, gdbSNP:147392032
622+c, tdbSNP:11692021
634+a, gdbSNP:193199170
643+a, gdbSNP:372920102
660+c, tdbSNP:45462096
672+a, cdbSNP:367786048
694+a, tdbSNP:28969713
702+c, tdbSNP:200299318
712+c, tdbSNP:141296723
719+c, tdbSNP:371311391
729+c, tdbSNP:140179150
753+a, gdbSNP:376167596
756+a, gdbSNP:17864686
757+g, tdbSNP:71423608
759+c, gdbSNP:201654358
760+c, tdbSNP:201879946
761+a, gdbSNP:144940363
769+g, tdbSNP:200834770
782+a, gdbSNP:149070815
803+a, gdbSNP:369092989
812+c, tdbSNP:372834137
815+c, tdbSNP:369493706
828+a, cdbSNP:141393523
831+c, tdbSNP:200244233
854+c, tdbSNP:147013594
872+dbSNP:
872+c, tdbSNP:72551347
914+a, gdbSNP:62625011
940+a, gdbSNP:114000345
955+a, gdbSNP:200903749
956+c, tdbSNP:17851756
968+a, tdbSNP:372326047
977+c, tdbSNP:202035422
982+c, tdbSNP:111033539
983+a, gdbSNP:72551348
997+dbSNP:
997+c, tdbSNP:139607673
1012+c, tdbSNP:72551349
1019+c, tdbSNP:144978321
1023+a, tdbSNP:149750520
1028+c, tdbSNP:201372184
1038+a, gdbSNP:377501831
1060+c, tdbSNP:72551350
1061+a, gdbSNP:72551351
1066+a, gdbSNP:267599273
1082+dbSNP:
1082+c, tdbSNP:34946978
1084+a, gdbSNP:367784507
1085+c, tdbSNP:371224646
1090+c, gdbSNP:55750087
1091+g, tdbSNP:374047963
1093+a, gdbSNP:72551352
1113+c, tdbSNP:139698110
1115+c, tdbSNP:72551353
1134+c, gdbSNP:72551354
1147+a, gdbSNP:143573365
1175+g, tdbSNP:367897068
1189+a, c, gdbSNP:28934877
1192+c, gdbSNP:72551355
1199+a, gdbSNP:140613392
1200+c, tdbSNP:114941320
1222+g, tdbSNP:36076514
1270+c, tdbSNP:11682453
1273+a, gdbSNP:72551356
1300+dbSNP:
1300+a, tdbSNP:72551357
1313+c, tdbSNP:202172337
1315+c, tdbSNP:143033456
1339+c, tdbSNP:201427749
1340+a, g, tdbSNP:200370335
1343+c, tdbSNP:114982090
1344+a, gdbSNP:368860136
1364+c, tdbSNP:373052727
1369+c, tdbSNP:115410088
1379+a, cdbSNP:72551358
1380+c, gdbSNP:115944950
1405+c, tdbSNP:377565834
1411+a, cdbSNP:72551359
1415+a, gdbSNP:150687296
1419+c, tdbSNP:28900406
1428+a, cdbSNP:369610863
1443+c, tdbSNP:147132183
1447+a, g, tdbSNP:34993780
1449+c, tdbSNP:142077822
1450+c, tdbSNP:371183955
1454+c, g, tdbSNP:72551360
1461+c, tdbSNP:114123636
1478+a, tdbSNP:72551361
1482+c, tdbSNP:199539868
1486+a, gdbSNP:199723856
1509+a, cdbSNP:190427553
1522+c, gdbSNP:1042709
1533+g, tdbSNP:200144439
1596+a, gdbSNP:1042710
1620+c, tdbSNP:370727977
1640+c, tdbSNP:34895241
1668+a, tdbSNP:182019761
1677+c, tdbSNP:78684540
1781+g, tdbSNP:200041554
1804+c, tdbSNP:10929303
1846+c, tdbSNP:61757316
1932+c, gdbSNP:1042640
1938+c, tdbSNP:112908387
2012+c, tdbSNP:34942353
2032+c, tdbSNP:138626513
2033+c, gdbSNP:8330
2033+c, gdbSNP:386496306
2042+, adbSNP:61757317
2054+g, tdbSNP:142810023
2263+g, tdbSNP:71539604
2285+c, tdbSNP:148128252
Gene SymbolUGT1A7
Gene SynonymUDPGT; UDPGT 1-7; UGT-1G; UGT1-07; UGT1.7; UGT1G
Chromosome2
Locus Map2q37
Title Discovery and refinement of loci associated with lipid levels .
Author Willer CJ, Schmidt EM, Sengupta S, Peloso GM, Gustafsson S, Kanoni S, Ganna A, Chen J, Buchkovich ML, Mora S, Beckmann JS, Bragg-Gresham JL, Chang HY, Demirkan A, Den Hertog HM, Do R, Donnelly LA, Ehret GB, Esko T, Feitosa MF, Ferreira T, Fischer K, Fontanillas P, Fraser RM, Freitag DF, Gurdasani D, Heikkila K, Hypponen E, Isaacs A, Jackson AU, Johansson A, Johnson T, Kaakinen M, Kettunen J, Kleber ME, Li X, Luan J, Lyytikainen LP, Magnusson PK, Mangino M, Mihailov E, Montasser ME, Muller-Nurasyid M, Nolte IM, O'Connell JR, Palmer CD, Perola M, Petersen AK, Sanna S, Saxena R, Service SK, Shah S, Shungin D, Sidore C, Song C, Strawbridge RJ, Surakka I, Tanaka T, Teslovich TM, Thorleifsson G, Van den Herik EG, Voight BF, Volcik KA, Waite LL, Wong A, Wu Y, Zhang W, Absher D, Asiki G, Barroso I, Been LF, Bolton JL, Bonnycastle LL, Brambilla P, Burnett MS, Cesana G, Dimitriou M, Doney AS, Doring A, Elliott P, Epstein SE, Eyjolfsson GI, Gigante B, Goodarzi MO, Grallert H, Gravito ML, Groves CJ, Hallmans G, Hartikainen AL, Hayward C, Hernandez D, Hicks AA, Holm H, Hung YJ, Illig T, Jones MR, Kaleebu P, Kastelein JJ, Khaw KT, Kim E, Klopp N, Komulainen P, Kumari M, Langenberg C, Lehtimaki T, Lin SY, Lindstrom J, Loos RJ, Mach F, McArdle WL, Meisinger C, Mitchell BD, Muller G, Nagaraja R, Narisu N, Nieminen TV, Nsubuga RN, Olafsson I, Ong KK, Palotie A, Papamarkou T, Pomilla C, Pouta A, Rader DJ, Reilly MP, Ridker PM, Rivadeneira F, Rudan I, Ruokonen A, Samani N, Scharnagl H, Seeley J, Silander K, Stancakova A, Stirrups K, Swift AJ, Tiret L, Uitterlinden AG, van Pelt LJ, Vedantam S, Wainwright N, Wijmenga C, Wild SH, Willemsen G, Wilsgaard T, Wilson JF, Young EH, Zhao JH, Adair LS, Arveiler D, Assimes TL, Bandinelli S, Bennett F, Bochud M, Boehm BO, Boomsma DI, Borecki IB, Bornstein SR, Bovet P, Burnier M, Campbell H, Chakravarti A, Chambers JC, Chen YD, Collins FS, Cooper RS, Danesh J, Dedoussis G, de Faire U, Feranil AB, Ferrieres J, Ferrucci L, Freimer NB, Gieger C, Groop LC, Gudnason V, Gyllensten U, Hamsten A, Harris TB, Hingorani A, Hirschhorn JN, Hofman A, Hovingh GK, Hsiung CA, Humphries SE, Hunt SC, Hveem K, Iribarren C, Jarvelin MR, Jula A, Kahonen M, Kaprio J, Kesaniemi A, Kivimaki M, Kooner JS, Koudstaal PJ, Krauss RM, Kuh D, Kuusisto J, Kyvik KO, Laakso M, Lakka TA, Lind L, Lindgren CM, Martin NG, Marz W, McCarthy MI, McKenzie CA, Meneton P, Metspalu A, Moilanen L, Morris AD, Munroe PB, Njolstad I, Pedersen NL, Power C, Pramstaller PP, Price JF, Psaty BM, Quertermous T, Rauramaa R, Saleheen D, Salomaa V, Sanghera DK, Saramies J, Schwarz PE, Sheu WH, Shuldiner AR, Siegbahn A, Spector TD, Stefansson K, Strachan DP, Tayo BO, Tremoli E, Tuomilehto J, Uusitupa M, van Duijn CM, Vollenweider P, Wallentin L, Wareham NJ, Whitfield JB, Wolffenbuttel BH, Ordovas JM, Boerwinkle E, Palmer CN, Thorsteinsdottir U, Chasman DI, Rotter JI, Franks PW, Ripatti S, Cupples LA, Sandhu MS, Rich SS, Boehnke M, Deloukas P, Kathiresan S, Mohlke KL, Ingelsson E and Abecasis GR.
Journal Nat. Genet. 45 (11), 1274-1283 (2013)
Title Association of SNPs in the UGT1A gene cluster with total bilirubin and mortality in the Diabetes Heart Study .
Author Cox AJ, Ng MC, Xu J, Langefeld CD, Koch KL, Dawson PA, Carr JJ, Freedman BI, Hsu FC and Bowden DW.
Journal Atherosclerosis 229 (1), 155-160 (2013)
Title A genome-wide association study for serum bilirubin levels and gene-environment interaction in a Chinese population .
Author Dai X, Wu C, He Y, Gui L, Zhou L, Guo H, Yuan J, Yang B, Li J, Deng Q, Huang S, Guan L, Hu D, Zhu J, Min X, Lang M, Li D, Yang H, Hu FB, Lin D, Wu T and He M.
Journal Genet. Epidemiol. 37 (3), 293-300 (2013)
Title A genome-wide assessment of variability in human serum metabolism .
Author Hong MG, Karlsson R, Magnusson PK, Lewis MR, Isaacs W, Zheng LS, Xu J, Gronberg H, Ingelsson E, Pawitan Y, Broeckling C, Prenni JE, Wiklund F and Prince JA.
Journal Hum. Mutat. 34 (3), 515-524 (2013)
Title Association between polymorphisms in UDP-glucuronosyltransferase 1A6 and 1A7 and colorectal cancer risk .
Author Osawa K, Nakarai C, Akiyama M, Hashimoto R, Tsutou A, Takahashi J, Takaoka Y, Kawamura S, Shimada E, Tanaka K, Kozuka M, Yamamoto M and Kido Y.
Journal Asian Pac. J. Cancer Prev. 13 (5), 2311-2314 (2012)
Title Structural heterogeneity at the UDP-glucuronosyltransferase 1 locus: functional consequences of three novel missense mutations in the human UGT1A7 gene .
Author Guillemette C, Ritter JK, Auyeung DJ, Kessler FK and Housman DE.
Journal Pharmacogenetics 10 (7), 629-644 (2000)
Title Human UDP-glucuronosyltransferases: metabolism, expression, and disease .
Author Tukey RH and Strassburg CP.
Journal Annu. Rev. Pharmacol. Toxicol. 40, 581-616 (2000)
Title The UDP glycosyltransferase gene superfamily: recommended nomenclature update based on evolutionary divergence .
Author Mackenzie PI, Owens IS, Burchell B, Bock KW, Bairoch A, Belanger A, Fournel-Gigleux S, Green M, Hum DW, Iyanagi T, Lancet D, Louisot P, Magdalou J, Chowdhury JR, Ritter JK, Schachter H, Tephly TR, Tipton
Journal Pharmacogenetics 7 (4), 255-269 (1997)
Title Differential expression of the UGT1A locus in human liver, biliary, and gastric tissue: identification of UGT1A7 and UGT1A10 transcripts in extrahepatic tissue .
Author Strassburg CP, Oldhafer K, Manns MP and Tukey RH.
Journal Mol. Pharmacol. 52 (2), 212-220 (1997)
Title Assignment of the human UDP glucuronosyltransferase gene (UGT1A1) to chromosome region 2q37 .
Author van Es HH, Bout A, Liu J, Anderson L, Duncan AM, Bosma P, Oude Elferink R, Jansen PL, Chowdhury JR and Schurr E.
Journal Cytogenet. Cell Genet. 63 (2), 114-116 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.