• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens spalt-like transcription factor 4 (SALL4), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18258 Homo sapiens spalt-like transcription factor 4 (SALL4), mRNA. pcDNA3.1+-DYK On-demand $1699.00 25
OHu18258C Homo sapiens spalt-like transcription factor 4 (SALL4), mRNA. Customized vector On-demand $1699.00 25

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_020436.3, 187173293
Length 3162 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens spalt-like transcription factor 4 (SALL4), mRNA.
Product sal-like protein 4
Comment

Summary: The protein encoded by this gene may be a zinc finger transcription factor. Defects in this gene are a cause of Duane-radial ray syndrome (DRRS). [provided by RefSeq, Jul 2008].

RefSeq NP_065169.1
CDS 102..3263
Misc Feature(1)66..68
Misc Feature(2)270..272
Misc Feature(3)270..272
Misc Feature(4)1020..1022
Misc Feature(5)1245..1313
Misc Feature(6)1287..1364
Misc Feature(7)1722..1724
Misc Feature(8)1785..>2861
Misc Feature(9)1839..1916
Misc Feature(10)1977..2045
Misc Feature(11)2343..2345
Misc Feature(12)2427..2429
Misc Feature(13)2466..2468
Misc Feature(14)2472..>2774
Misc Feature(15)2655..2657
Misc Feature(16)order(2715..2717,2724..2726,2763..2765)
Misc Feature(17)2751..2828
Misc Feature(18)3156..3158
Exon (1)1..231
Gene:SALL4
Gene Synonym:dJ1112F19.1; DRRS; HSAL4; ZNF797
Exon (2)232..2562
Gene:SALL4
Gene Synonym:dJ1112F19.1; DRRS; HSAL4; ZNF797
Exon (3)2563..2843
Gene:SALL4
Gene Synonym:dJ1112F19.1; DRRS; HSAL4; ZNF797
Exon (4)2844..3486
Gene:SALL4
Gene Synonym:dJ1112F19.1; DRRS; HSAL4; ZNF797
Translation MSRRKQAKPQHINSEEDQGEQQPQQQTPEFADAAPAAPAAGELGAPVNHPGNDEVASEDE ATVKRLRREETHVCEKCCAEFFSISEFLEHKKNCTKNPPVLIMNDSEGPVPSEDFSGAVL SHQPTSPGSKDCHRENGGSSEDMKEKPDAESVVYLKTETALPPTPQDISYLAKGKVANTN VTLQALRGTKVAVNQRSADALPAPVPGANSIPWVLEQILCLQQQQLQQIQLTEQIRIQVN MWASHALHSSGAGADTLKTLGSHMSQQVSAAVALLSQKAGSQGLSLDALKQAKLPHANIP SATSSLSPGLAPFTLKPDGTRVLPNVMSRLPSALLPQAPGSVLFQSPFSTVALDTSKKGK GKPPNISAVDVKPKDEAALYKHKCKYCSKVFGTDSSLQIHLRSHTGERPFVCSVCGHRFT TKGNLKVHFHRHPQVKANPQLFAEFQDKVAAGNGIPYALSVPDPIDEPSLSLDSKPVLVT TSVGLPQNLSSGTNPKDLTGGSLPGDLQPGPSPESEGGPTLPGVGPNYNSPRAGGFQGSG TPEPGSETLKLQQLVENIDKATTDPNECLICHRVLSCQSSLKMHYRTHTGERPFQCKICG RAFSTKGNLKTHLGVHRTNTSIKTQHSCPICQKKFTNAVMLQQHIRMHMGGQIPNTPLPE NPCDFTGSEPMTVGENGSTGAICHDDVIESIDVEEVSSQEAPSSSSKVPTPLPSIHSASP TLGFAMMASLDAPGKVGPAPFNLQRQGSRENGSVESDGLTNDSSSLMGDQEYQSRSPDIL ETTSFQALSPANSQAESIKSKSPDAGSKAESSENSRTEMEGRSSLPSTFIRAPPTYVKVE VPGTFVGPSTLSPGMTPLLAAQPRRQAKQHGCTRCGKNFSSASALQIHERTHTGEKPFVC NICGRAFTTKGNLKVHYMTHGANNNSARRGRKLAIENTMALLGTDGKRVSEIFPKEILAP SVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQ SGISADVEKPSATDGVPKHQFPHFLEENKIAVS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(59)-dbSNP:
complement(59)-t, cdbSNP:377245709
complement(60)-t, cdbSNP:372607123
61+, gdbSNP:74938823
complement(79)-g, adbSNP:369171253
complement(96)-t, gdbSNP:375752021
complement(110)-t, cdbSNP:144854765
complement(122)-t, cdbSNP:372815479
complement(125)-t, cdbSNP:149430070
complement(140)-g, adbSNP:200423405
complement(143)-g, cdbSNP:137903141
complement(164)-g, cdbSNP:201062220
complement(220)-g, adbSNP:201955525
complement(225)-t, cdbSNP:200440024
complement(260)-dbSNP:
complement(260)-g, adbSNP:146185073
complement(268)-g, adbSNP:375832746
complement(269)-t, cdbSNP:370634519
complement(303)-g, adbSNP:202087308
complement(313)-g, adbSNP:374255657
complement(314)-t, cdbSNP:141479802
complement(317)-g, adbSNP:138604469
complement(318)-t, cdbSNP:370245881
complement(382)-g, cdbSNP:377448200
complement(385)-g, cdbSNP:374594645
complement(418)-t, cdbSNP:150110610
complement(419)-g, adbSNP:371144604
complement(429)-t, cdbSNP:141750452
complement(440)-t, cdbSNP:73911279
complement(450)-t, cdbSNP:77538589
509+c, tdbSNP:76870996
complement(512)-g, adbSNP:201560082
complement(547)-g, adbSNP:371371697
complement(548)-t, cdbSNP:147838161
complement(557)-g, cdbSNP:369005189
complement(598)-t, cdbSNP:146411998
624+a, tdbSNP:74315426
complement(627)-t, cdbSNP:142325001
complement(630)-t, cdbSNP:145275500
complement(637)-g, cdbSNP:201303046
complement(641)-g, adbSNP:6013281
complement(642)-t, cdbSNP:139382539
complement(676)-t, gdbSNP:376632759
complement(687)-g, adbSNP:151297824
complement(689)-t, cdbSNP:143754390
complement(695)-t, cdbSNP:377028033
complement(710)-t, gdbSNP:200416079
complement(713)-g, adbSNP:367890518
complement(746)-g, cdbSNP:61737139
complement(747)-t, cdbSNP:45621331
complement(794)-g, cdbSNP:370747731
complement(797)-g, adbSNP:376488018
complement(803)-t, cdbSNP:146143890
complement(863)-g, adbSNP:141546409
complement(867)-t, cdbSNP:139802240
complement(883)-t, cdbSNP:199623438
complement(890)-g, adbSNP:374042570
complement(989)-g, adbSNP:113287064
complement(1010)-t, gdbSNP:367739959
complement(1051)-g, adbSNP:149863527
complement(1062)-t, gdbSNP:143984107
complement(1063)-t, cdbSNP:373872511
complement(1064)-c, adbSNP:374815682
complement(1073)-t, cdbSNP:149482138
complement(1086)-g, adbSNP:370973464
complement(1087)-t, cdbSNP:376519013
complement(1097)-g, adbSNP:137963401
complement(1104)-g, adbSNP:374189772
complement(1106)-g, adbSNP:150350828
complement(1118)-t, cdbSNP:369583589
complement(1119)-t, cdbSNP:181072784
complement(1121)-g, adbSNP:142790611
complement(1157)-t, cdbSNP:13038893
complement(1166)-t, cdbSNP:146118858
complement(1171)-t, cdbSNP:376159562
complement(1193)-t, cdbSNP:373365568
complement(1205)-t, cdbSNP:142357063
1214+c, gdbSNP:77810153
complement(1306)-t, cdbSNP:145735478
complement(1345)-c, adbSNP:200431537
complement(1376)-g, adbSNP:267605995
complement(1388)-c, adbSNP:143818932
complement(1404)-t, cdbSNP:373070046
complement(1454)-g, adbSNP:140110863
complement(1459)-t, cdbSNP:146644204
complement(1492)-g, adbSNP:139485493
complement(1494)-t, cdbSNP:370363837
complement(1505)-t, cdbSNP:377687355
complement(1514)-g, adbSNP:150512849
complement(1573)-g, adbSNP:141604488
complement(1598)-c, adbSNP:148435082
complement(1605)-g, adbSNP:147369767
complement(1607)-g, adbSNP:142827249
complement(1613)-g, adbSNP:138804604
complement(1614)-t, cdbSNP:200920825
complement(1621)-c, adbSNP:6126344
complement(1630)-t, cdbSNP:201321572
1658+c, tdbSNP:75554760
complement(1668)-t, cdbSNP:113920122
complement(1678)-g, adbSNP:367732231
complement(1707)-g, adbSNP:112475938
complement(1731)-g, adbSNP:150402866
complement(1816)-t, cdbSNP:199643138
complement(1827)-t, cdbSNP:140430438
complement(1838)-g, cdbSNP:368912905
complement(1843)-g, adbSNP:200870343
complement(1850)-c, adbSNP:374228887
complement(1857)-g, cdbSNP:148328518
complement(1868)-g, adbSNP:201329321
complement(1880)-c, adbSNP:147254025
complement(1906)-t, gdbSNP:371251316
1950+c, tdbSNP:74315427
complement(1961)-t, cdbSNP:6021437
complement(1972)-g, adbSNP:146604877
complement(1973)-t, cdbSNP:144361561
complement(2051)-g, adbSNP:149008635
2055+c, tdbSNP:74315424
complement(2069)-t, cdbSNP:371853419
complement(2072)-g, adbSNP:145851373
complement(2093..2094)-, adbSNP:35471036
complement(2098)-g, adbSNP:201311352
complement(2102)-t, adbSNP:143894712
complement(2138)-g, adbSNP:13043248
complement(2139)-t, cdbSNP:139022152
complement(2142)-t, cdbSNP:147385529
complement(2150)-g, cdbSNP:144301539
complement(2152..2154)-, catdbSNP:372232988
complement(2175)-t, cdbSNP:368110603
complement(2195)-g, adbSNP:185571842
complement(2213)-g, adbSNP:373599550
complement(2215)-g, cdbSNP:370485562
complement(2231)-t, cdbSNP:61737143
complement(2233)-g, adbSNP:376862008
complement(2263)-g, adbSNP:147195029
complement(2267)-t, cdbSNP:141708963
complement(2283)-g, cdbSNP:61737142
complement(2316)-c, adbSNP:41274696
complement(2319)-g, cdbSNP:149359253
complement(2331)-t, gdbSNP:371138116
complement(2334)-g, adbSNP:111502708
complement(2335)-t, cdbSNP:202211021
complement(2360)-g, adbSNP:369158623
complement(2361)-t, cdbSNP:199607966
complement(2363)-t, cdbSNP:138721208
complement(2369)-g, adbSNP:145078336
complement(2384)-t, gdbSNP:372756084
complement(2391)-g, adbSNP:150549656
complement(2424)-t, gdbSNP:201272780
complement(2438)-g, adbSNP:138274486
complement(2450)-t, cdbSNP:145820443
complement(2465)-g, cdbSNP:140533318
complement(2477)-g, adbSNP:143601538
complement(2486)-g, adbSNP:142446452
complement(2493)-t, gdbSNP:6091375
complement(2511)-t, cdbSNP:147768774
complement(2526)-c, adbSNP:144159154
complement(2584)-dbSNP:
complement(2584)-g, adbSNP:147158259
2594+a, gdbSNP:79909922
complement(2600)-t, cdbSNP:139138176
complement(2601)-g, adbSNP:201751248
complement(2616)-c, adbSNP:150805097
complement(2626)-g, adbSNP:367912172
2694+c, tdbSNP:74315425
complement(2707)-t, gdbSNP:374776890
complement(2721)-g, adbSNP:141341062
complement(2741)-g, cdbSNP:17802735
2764+a, gdbSNP:74315429
complement(2765)-g, adbSNP:11698418
2814+c, tdbSNP:74315428
complement(2882)-dbSNP:
complement(2882)-g, adbSNP:200560828
complement(2883)-g, adbSNP:201682235
complement(2887)-t, cdbSNP:200956651
complement(2889)-g, cdbSNP:200010743
complement(2906)-g, adbSNP:146025163
complement(2933)-t, cdbSNP:138337762
complement(2936)-g, adbSNP:143702441
complement(2957)-g, adbSNP:369810955
complement(3003)-c, adbSNP:199529190
complement(3004)-c, adbSNP:377276752
complement(3031)-t, cdbSNP:149412142
complement(3035)-g, adbSNP:369618385
complement(3044)-g, adbSNP:375677541
complement(3055)-t, cdbSNP:372095837
complement(3064)-t, gdbSNP:368410861
complement(3075)-t, cdbSNP:374406769
complement(3078)-t, g, c, adbSNP:138891224
complement(3097)-g, cdbSNP:150281143
complement(3119)-g, adbSNP:141101879
complement(3132)-t, cdbSNP:370661697
complement(3163)-g, adbSNP:147732522
complement(3164)-t, cdbSNP:145790154
complement(3165)-g, cdbSNP:142713222
complement(3166)-g, cdbSNP:371749353
complement(3170)-t, gdbSNP:376560016
complement(3173)-t, adbSNP:201347828
complement(3181)-c, adbSNP:373111608
complement(3197)-g, adbSNP:370319434
3204+a, gdbSNP:76648342
complement(3207)-t, cdbSNP:377696653
complement(3250)-g, adbSNP:189552205
complement(3253)-g, adbSNP:373555761
complement(3254)-t, cdbSNP:142551587
complement(3276)-t, cdbSNP:369602063
complement(3311)-g, cdbSNP:61301565
complement(3368)-g, adbSNP:370274295
3388+a, tdbSNP:3171177
complement(3464..3465)-, tdbSNP:397953057
complement(3474..3475)-, tdbSNP:59841639
Gene SymbolSALL4
Gene SynonymdJ1112F19.1; DRRS; HSAL4; ZNF797
Chromosome20
Locus Map20q13.2
Title SALL4 expression in germ cell and non-germ cell tumors: a systematic immunohistochemical study of 3215 cases .
Author Miettinen M, Wang Z, McCue PA, Sarlomo-Rikala M, Rys J, Biernat W, Lasota J and Lee YS.
Journal Am. J. Surg. Pathol. 38 (3), 410-420 (2014)
Title A SALL4/MLL/HOXA9 pathway in murine and human myeloid leukemogenesis .
Author Li,A., Yang,Y., Gao,C., Lu,J., Jeong,H.W., Liu,B.H., Tang,P., Yao,X., Neuberg,D., Huang,G., Tenen,D.G. and Chai,L.
Journal J. Clin. Invest. 123 (10), 4195-4207 (2013)
Title Sal-like 4 (SALL4) suppresses CDH1 expression and maintains cell dispersion in basal-like breast cancer .
Author Itou J, Matsumoto Y, Yoshikawa K and Toi M.
Journal FEBS Lett. 587 (18), 3115-3121 (2013)
Title SALL4 is a marker of the embryonal subtype of hepatoblastoma .
Author Gnemmi V, Leteurtre E, Sudour-Bonnange H, Devisme L, Guettier C, Buob D and Leroy X.
Journal Histopathology 63 (3), 425-428 (2013)
Title Oncofetal gene SALL4 in aggressive hepatocellular carcinoma .
Author Yong KJ, Gao C, Lim JS, Yan B, Yang H, Dimitrov T, Kawasaki A, Ong CW, Wong KF, Lee S, Ravikumar S, Srivastava S, Tian X, Poon RT, Fan ST, Luk JM, Dan YY, Salto-Tellez M, Chai L and Tenen DG.
Journal N. Engl. J. Med. 368 (24), 2266-2276 (2013)
Title Novel mutations in the gene SALL4 provide further evidence for acro-renal-ocular and Okihiro syndromes being allelic entities, and extend the phenotypic spectrum .
Author Borozdin,W., Wright,M.J., Hennekam,R.C., Hannibal,M.C., Crow,Y.J., Neumann,T.E. and Kohlhase,J.
Journal J. Med. Genet. 41 (8), E102 (2004)
Title Mutations at the SALL4 locus on chromosome 20 result in a range of clinically overlapping phenotypes, including Okihiro syndrome, Holt-Oram syndrome, acro-renal-ocular syndrome, and patients previously reported to represent thalidomide embryopathy .
Author Kohlhase J, Schubert L, Liebers M, Rauch A, Becker K, Mohammed SN, Newbury-Ecob R and Reardon W.
Journal J. Med. Genet. 40 (7), 473-478 (2003)
Title Okihiro syndrome is caused by SALL4 mutations .
Author Kohlhase J, Heinrich M, Schubert L, Liebers M, Kispert A, Laccone F, Turnpenny P, Winter RM and Reardon W.
Journal Hum. Mol. Genet. 11 (23), 2979-2987 (2002)
Title Duane radial ray syndrome (Okihiro syndrome) maps to 20q13 and results from mutations in SALL4, a new member of the SAL family .
Author Al-Baradie R, Yamada K, St Hilaire C, Chan WM, Andrews C, McIntosh N, Nakano M, Martonyi EJ, Raymond WR, Okumura S, Okihiro MM and Engle EC.
Journal Am. J. Hum. Genet. 71 (5), 1195-1199 (2002)
Title SALL4-Related Disorders .
Author Kohlhase,J.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.