• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens sal-like 4 (Drosophila) (SALL4), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_020436 Homo sapiens sal-like 4 (Drosophila) (SALL4), mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_020436.3, 187173293
Length 3487 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens sal-like 4 (Drosophila) (SALL4), mRNA.
Product sal-like protein 4
Comment

Summary: The protein encoded by this gene may be a zinc finger transcription factor. Defects in this gene are a cause of Duane-radial ray syndrome (DRRS). [provided by RefSeq, Jul 2008].

RefSeq NP_065169.1
CDS 102..3263
Misc Feature(1)66..68
Misc Feature(2)1020..1022
Misc Feature(3)1020..1022
Misc Feature(4)1245..1313
Misc Feature(5)1287..1364
Misc Feature(6)1722..1724
Misc Feature(7)1839..1916
Misc Feature(8)1977..2045
Misc Feature(9)2343..2345
Misc Feature(10)2427..2429
Misc Feature(11)2466..2468
Misc Feature(12)2715..2777
Misc Feature(13)2751..2828
Misc Feature(14)3156..3158
Exon (1)1..231
Gene:SALL4
Gene Synonym:dJ1112F19.1; DRRS; HSAL4; ZNF797
Exon (2)232..2562
Gene:SALL4
Gene Synonym:dJ1112F19.1; DRRS; HSAL4; ZNF797
Exon (3)2563..2843
Gene:SALL4
Gene Synonym:dJ1112F19.1; DRRS; HSAL4; ZNF797
Exon (4)2844..3486
Gene:SALL4
Gene Synonym:dJ1112F19.1; DRRS; HSAL4; ZNF797
Translation MSRRKQAKPQHINSEEDQGEQQPQQQTPEFADAAPAAPAAGELGAPVNHPGNDEVASEDE ATVKRLRREETHVCEKCCAEFFSISEFLEHKKNCTKNPPVLIMNDSEGPVPSEDFSGAVL SHQPTSPGSKDCHRENGGSSEDMKEKPDAESVVYLKTETALPPTPQDISYLAKGKVANTN VTLQALRGTKVAVNQRSADALPAPVPGANSIPWVLEQILCLQQQQLQQIQLTEQIRIQVN MWASHALHSSGAGADTLKTLGSHMSQQVSAAVALLSQKAGSQGLSLDALKQAKLPHANIP SATSSLSPGLAPFTLKPDGTRVLPNVMSRLPSALLPQAPGSVLFQSPFSTVALDTSKKGK GKPPNISAVDVKPKDEAALYKHKCKYCSKVFGTDSSLQIHLRSHTGERPFVCSVCGHRFT TKGNLKVHFHRHPQVKANPQLFAEFQDKVAAGNGIPYALSVPDPIDEPSLSLDSKPVLVT TSVGLPQNLSSGTNPKDLTGGSLPGDLQPGPSPESEGGPTLPGVGPNYNSPRAGGFQGSG TPEPGSETLKLQQLVENIDKATTDPNECLICHRVLSCQSSLKMHYRTHTGERPFQCKICG RAFSTKGNLKTHLGVHRTNTSIKTQHSCPICQKKFTNAVMLQQHIRMHMGGQIPNTPLPE NPCDFTGSEPMTVGENGSTGAICHDDVIESIDVEEVSSQEAPSSSSKVPTPLPSIHSASP TLGFAMMASLDAPGKVGPAPFNLQRQGSRENGSVESDGLTNDSSSLMGDQEYQSRSPDIL ETTSFQALSPANSQAESIKSKSPDAGSKAESSENSRTEMEGRSSLPSTFIRAPPTYVKVE VPGTFVGPSTLSPGMTPLLAAQPRRQAKQHGCTRCGKNFSSASALQIHERTHTGEKPFVC NICGRAFTTKGNLKVHYMTHGANNNSARRGRKLAIENTMALLGTDGKRVSEIFPKEILAP SVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQ SGISADVEKPSATDGVPKHQFPHFLEENKIAVS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(61)-dbSNP:
complement(61)-, gdbSNP:74938823
complement(110)-t, cdbSNP:144854765
complement(125)-t, cdbSNP:149430070
complement(140)-g, adbSNP:200423405
complement(143)-g, cdbSNP:137903141
complement(164)-g, cdbSNP:201062220
complement(220)-g, adbSNP:201955525
complement(225)-t, cdbSNP:200440024
complement(260)-dbSNP:
complement(260)-g, adbSNP:146185073
complement(303)-g, adbSNP:202087308
complement(314)-t, cdbSNP:141479802
complement(317)-g, adbSNP:138604469
complement(418)-t, cdbSNP:150110610
complement(429)-t, cdbSNP:141750452
complement(440)-t, cdbSNP:73911279
complement(450)-t, cdbSNP:77538589
complement(509)-t, cdbSNP:76870996
complement(512)-g, adbSNP:201560082
complement(548)-t, cdbSNP:147838161
complement(598)-t, cdbSNP:146411998
complement(624)-t, adbSNP:74315426
complement(627)-t, cdbSNP:142325001
complement(630)-t, cdbSNP:145275500
complement(637)-g, cdbSNP:201303046
complement(641)-g, adbSNP:6013281
complement(642)-t, cdbSNP:139382539
complement(687)-g, adbSNP:151297824
complement(689)-t, cdbSNP:143754390
complement(710)-t, gdbSNP:200416079
complement(746)-g, cdbSNP:61737139
complement(747)-t, cdbSNP:45621331
complement(803)-t, cdbSNP:146143890
complement(863)-g, adbSNP:141546409
complement(867)-t, cdbSNP:139802240
complement(883)-t, cdbSNP:199623438
complement(989)-g, adbSNP:113287064
complement(1051)-g, adbSNP:149863527
complement(1062)-t, gdbSNP:143984107
complement(1073)-t, cdbSNP:149482138
complement(1097)-g, adbSNP:137963401
complement(1106)-g, adbSNP:150350828
complement(1119)-t, cdbSNP:181072784
complement(1121)-g, adbSNP:142790611
complement(1157)-t, cdbSNP:13038893
complement(1166)-t, cdbSNP:146118858
complement(1205)-t, cdbSNP:142357063
complement(1214)-g, cdbSNP:77810153
complement(1245)-t, gdbSNP:151035565
complement(1270)-t, adbSNP:143732082
complement(1305)-g, adbSNP:148956768
complement(1306)-t, cdbSNP:145735478
complement(1345)-c, adbSNP:200431537
complement(1388)-c, adbSNP:143818932
complement(1454)-g, adbSNP:140110863
complement(1459)-t, cdbSNP:146644204
complement(1476)-g, adbSNP:144505438
complement(1492)-g, adbSNP:139485493
complement(1514)-g, adbSNP:150512849
complement(1573)-g, adbSNP:141604488
complement(1598)-c, adbSNP:148435082
complement(1605)-g, adbSNP:147369767
complement(1607)-g, adbSNP:142827249
complement(1613)-g, adbSNP:138804604
complement(1614)-t, cdbSNP:200920825
complement(1621)-c, adbSNP:6126344
complement(1630)-t, cdbSNP:201321572
complement(1658)-t, cdbSNP:75554760
complement(1668)-t, cdbSNP:113920122
complement(1698)-c, adbSNP:138065310
complement(1707)-g, adbSNP:112475938
complement(1731)-g, adbSNP:150402866
complement(1816)-t, cdbSNP:199643138
complement(1827)-t, cdbSNP:140430438
complement(1843)-g, adbSNP:200870343
complement(1857)-g, cdbSNP:148328518
complement(1868)-g, adbSNP:201329321
complement(1880)-c, adbSNP:147254025
complement(1950)-t, cdbSNP:74315427
complement(1961)-t, cdbSNP:6021437
complement(1972)-g, adbSNP:146604877
complement(1973)-t, cdbSNP:144361561
complement(2051)-g, adbSNP:149008635
complement(2055)-t, cdbSNP:74315424
complement(2072)-g, adbSNP:145851373
complement(2095..2096)-, adbSNP:35471036
complement(2098)-g, adbSNP:201311352
complement(2102)-t, adbSNP:143894712
complement(2138)-g, adbSNP:13043248
complement(2139)-t, cdbSNP:139022152
complement(2142)-t, cdbSNP:147385529
complement(2150)-g, cdbSNP:144301539
complement(2195)-g, adbSNP:185571842
complement(2231)-t, cdbSNP:61737143
complement(2263)-g, adbSNP:147195029
complement(2267)-t, cdbSNP:141708963
complement(2283)-g, cdbSNP:61737142
complement(2316)-c, adbSNP:41274696
complement(2319)-g, cdbSNP:149359253
complement(2334)-g, adbSNP:111502708
complement(2335)-t, cdbSNP:202211021
complement(2361)-t, cdbSNP:199607966
complement(2363)-t, cdbSNP:138721208
complement(2369)-g, adbSNP:145078336
complement(2391)-g, adbSNP:150549656
complement(2424)-t, gdbSNP:201272780
complement(2438)-g, adbSNP:138274486
complement(2450)-t, cdbSNP:145820443
complement(2465)-g, cdbSNP:140533318
complement(2477)-g, adbSNP:143601538
complement(2486)-g, adbSNP:142446452
complement(2493)-t, gdbSNP:6091375
complement(2511)-t, cdbSNP:147768774
complement(2526)-c, adbSNP:144159154
complement(2583)-dbSNP:
complement(2583)-t, adbSNP:140404293
complement(2584)-g, adbSNP:147158259
complement(2594)-g, adbSNP:79909922
complement(2600)-t, cdbSNP:139138176
complement(2601)-g, adbSNP:201751248
complement(2616)-c, adbSNP:150805097
complement(2694)-t, cdbSNP:74315425
complement(2721)-g, adbSNP:141341062
complement(2741)-g, cdbSNP:17802735
complement(2764)-g, adbSNP:74315429
complement(2765)-g, adbSNP:11698418
complement(2814)-t, cdbSNP:74315428
complement(2882)-dbSNP:
complement(2882)-g, adbSNP:200560828
complement(2883)-g, adbSNP:201682235
complement(2887)-t, cdbSNP:200956651
complement(2889)-g, cdbSNP:200010743
complement(2906)-g, adbSNP:146025163
complement(2933)-t, cdbSNP:138337762
complement(2936)-g, adbSNP:143702441
complement(3003)-c, adbSNP:199529190
complement(3031)-t, cdbSNP:149412142
complement(3078)-g, c, adbSNP:138891224
complement(3097)-g, cdbSNP:150281143
complement(3119)-g, adbSNP:141101879
complement(3163)-g, adbSNP:147732522
complement(3164)-t, cdbSNP:145790154
complement(3165)-g, cdbSNP:142713222
complement(3173)-t, adbSNP:201347828
complement(3198)-t, cdbSNP:141925935
complement(3204)-g, adbSNP:76648342
complement(3250)-g, adbSNP:189552205
complement(3254)-t, cdbSNP:142551587
complement(3311)-g, cdbSNP:61301565
complement(3388)-t, adbSNP:3171177
complement(3473..3474)-, tdbSNP:59841639
complement(3474..3475)-, tdbSNP:201087440
Gene SymbolSALL4
Gene SynonymdJ1112F19.1; DRRS; HSAL4; ZNF797
Chromosome20
Locus Map20q13.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_020436 Homo sapiens sal-like 4 (Drosophila) (SALL4), mRNA. On-demand $1699.00 25
Title Targeting transcription factor SALL4 in acute myeloid leukemia by interrupting its interaction with an epigenetic complex .
Author Gao,C., Dimitrov,T., Yong,K.J., Tatetsu,H., Jeong,H.W., Luo,H.R., Bradner,J.E., Tenen,D.G. and Chai,L.
Journal Blood 121 (8), 1413-1421 (2013)
Title Aberrant hypomethylation of SALL4 gene in patients with myelodysplastic syndrome .
Author Lin,J., Qian,J., Yao,D.M., Qian,W., Yang,J., Wang,C.Z., Chai,H.Y., Ma,J.C., Deng,Z.Q., Li,Y. and Chen,Q.
Journal Leuk. Res. 37 (1), 71-75 (2013)
Title CDX1 confers intestinal phenotype on gastric epithelial cells via induction of stemness-associated reprogramming factors SALL4 and KLF5 .
Author Fujii,Y., Yoshihashi,K., Suzuki,H., Tsutsumi,S., Mutoh,H., Maeda,S., Yamagata,Y., Seto,Y., Aburatani,H. and Hatakeyama,M.
Journal Proc. Natl. Acad. Sci. U.S.A. 109 (50), 20584-20589 (2012)
Title Sumoylation is important for stability, subcellular localization, and transcriptional activity of SALL4, an essential stem cell transcription factor .
Author Yang,F., Yao,Y., Jiang,Y., Lu,L., Ma,Y. and Dai,W.
Journal J. Biol. Chem. 287 (46), 38600-38608 (2012)
Title The expression and oncogenic effects of the embryonic stem cell marker SALL4 in ALK-positive anaplastic large cell lymphoma .
Author Wang,P., Zhang,J.D., Wu,F., Ye,X., Sharon,D., Hitt,M., McMullen,T.P., Hegazy,S.A., Gelebart,P., Yang,J., Ma,Y. and Lai,R.
Journal Cell. Signal. 24 (10), 1955-1963 (2012)
Title Mutations in SALL4 in malformed father and daughter postulated previously due to reflect mutagenesis by thalidomide .
Author Kohlhase,J. and Holmes,L.B.
Journal Birth Defects Res. Part A Clin. Mol. Teratol. 70 (8), 550-551 (2004)
Title Novel mutations in the gene SALL4 provide further evidence for acro-renal-ocular and Okihiro syndromes being allelic entities, and extend the phenotypic spectrum .
Author Borozdin,W., Wright,M.J., Hennekam,R.C., Hannibal,M.C., Crow,Y.J., Neumann,T.E. and Kohlhase,J.
Journal J. Med. Genet. 41 (8), E102 (2004)
Title Mutations at the SALL4 locus on chromosome 20 result in a range of clinically overlapping phenotypes, including Okihiro syndrome, Holt-Oram syndrome, acro-renal-ocular syndrome, and patients previously reported to represent thalidomide embryopathy .
Author Kohlhase,J., Schubert,L., Liebers,M., Rauch,A., Becker,K., Mohammed,S.N., Newbury-Ecob,R. and Reardon,W.
Journal J. Med. Genet. 40 (7), 473-478 (2003)
Title Okihiro syndrome is caused by SALL4 mutations .
Author Kohlhase,J., Heinrich,M., Schubert,L., Liebers,M., Kispert,A., Laccone,F., Turnpenny,P., Winter,R.M. and Reardon,W.
Journal Hum. Mol. Genet. 11 (23), 2979-2987 (2002)
Title Duane radial ray syndrome (Okihiro syndrome) maps to 20q13 and results from mutations in SALL4, a new member of the SAL family .
Author Al-Baradie,R., Yamada,K., St Hilaire,C., Chan,W.M., Andrews,C., McIntosh,N., Nakano,M., Martonyi,E.J., Raymond,W.R., Okumura,S., Okihiro,M.M. and Engle,E.C.
Journal Am. J. Hum. Genet. 71 (5), 1195-1199 (2002)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.