• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens prostaglandin F2 receptor inhibitor (PTGFRN), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_020440 Homo sapiens prostaglandin F2 receptor inhibitor (PTGFRN), mRNA. GenEZ ORF Cloning In-stock $809.00 $760.00 15

*Business Day

Related Services

RefSeq Version NM_020440.2, 41152505
Length 6160 bp
Structure linear
Update Date 26-JAN-2014
Organism Homo sapiens (human)
Definition Homo sapiens prostaglandin F2 receptor inhibitor (PTGFRN), mRNA.
Product prostaglandin F2 receptor negative regulator precursor
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AB037857.1. On or before Jan 24, 2004 this sequence version replaced gi:41221584, gi:40538733.

RefSeq NP_065173.2
CDS 138..2777
Misc Feature(1)225..557
Misc Feature(2)252..500
Misc Feature(3)<447..560
Misc Feature(4)984..>1250
Misc Feature(5)987..1265
Misc Feature(6)1407..1418
Misc Feature(7)2244..2252
Misc Feature(8)2634..2696
Exon (1)1..186
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Exon (2)187..555
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Exon (3)556..969
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Exon (4)970..1350
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Exon (5)1351..1776
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Exon (6)1777..2196
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Exon (7)2197..2304
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Exon (8)2305..2610
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Exon (9)2611..6160
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Translation MGRLASRPLLLALLSLALCRGRVVRVPTATLVRVVGTELVIPCNVSDYDGPSEQNFDWSF SSLGSSFVELASTWEVGFPAQLYQERLQRGEILLRRTANDAVELHIKNVQPSDQGHYKCS TPSTDATVQGNYEDTVQVKVLADSLHVGPSARPPPSLSLREGEPFELRCTAASASPLHTH LALLWEVHRGPARRSVLALTHEGRFHPGLGYEQRYHSGDVRLDTVGSDAYRLSVSRALSA DQGSYRCIVSEWIAEQGNWQEIQEKAVEVATVVIQPSVLRAAVPKNVSVAEGKELDLTCN ITTDRADDVRPEVTWSFSRMPDSTLPGSRVLARLDRDSLVHSSPHVALSHVDARSYHLLV RDVSKENSGYYYCHVSLWAPGHNRSWHKVAEAVSSPAGVGVTWLEPDYQVYLNASKVPGF ADDPTELACRVVDTKSGEANVRFTVSWYYRMNRRSDNVVTSELLAVMDGDWTLKYGERSK QRAQDGDFIFSKEHTDTFNFRIQRTTEEDRGNYYCVVSAWTKQRNNSWVKSKDVFSKPVN IFWALEDSVLVVKARQPKPFFAAGNTFEMTCKVSSKNIKSPRYSVLIMAEKPVGDLSSPN ETKYIISLDQDSVVKLENWTDASRVDGVVLEKVQEDEFRYRMYQTQVSDAGLYRCMVTAW SPVRGSLWREAATSLSNPIEIDFQTSGPIFNASVHSDTPSVIRGDLIKLFCIITVEGAAL DPDDMAFDVSWFAVHSFGLDKAPVLLSSLDRKGIVTTSRRDWKSDLSLERVSVLEFLLQV HGSEDQDFGNYYCSVTPWVKSPTGSWQKEAEIHSKPVFITVKMDVLNAFKYPLLIGVGLS TVIGLLSCLIGYCSSHWCCKKEVQETRRERRRLMSMEMD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
181+c, gdbSNP:77292583
196+dbSNP:
196+a, gdbSNP:374486687
223+c, tdbSNP:143995351
224+a, gdbSNP:375720205
278+c, tdbSNP:370008766
281+c, tdbSNP:34531926
409+a, cdbSNP:201525760
415+c, tdbSNP:111346071
431+c, tdbSNP:77895792
434+c, gdbSNP:149801733
440+c, tdbSNP:368615013
453+a, gdbSNP:372565948
491+a, gdbSNP:374330870
534+c, gdbSNP:368215880
599+dbSNP:
599+a, gdbSNP:80123219
647+c, tdbSNP:148769134
651+a, gdbSNP:368166849
661+c, tdbSNP:377067802
773+a, gdbSNP:371381104
822+a, gdbSNP:145790245
829+g, tdbSNP:368991785
838+c, tdbSNP:143781613
842+a, cdbSNP:371595972
857+c, tdbSNP:377293419
862+a, gdbSNP:142424201
868+c, tdbSNP:188883808
881+c, tdbSNP:373833228
888+c, gdbSNP:200993488
934+c, tdbSNP:137888350
945+g, tdbSNP:375593463
965..966+at, gadbSNP:71483896
965..966+at, gadbSNP:386634958
965+a, gdbSNP:10159095
966+a, tdbSNP:4546904
974+dbSNP:
974+a, gdbSNP:187821181
1040+c, tdbSNP:143073499
1055+c, tdbSNP:143746064
1070+c, tdbSNP:140719535
1078+c, tdbSNP:150849305
1127+g, tdbSNP:201270839
1134+c, tdbSNP:141382228
1135+a, gdbSNP:149030409
1165+c, tdbSNP:201175251
1189+c, tdbSNP:372882786
1218+c, tdbSNP:202082288
1223+g, tdbSNP:148214798
1263+g, tdbSNP:200214889
1277+c, tdbSNP:375968155
1278+a, gdbSNP:150341125
1280+a, gdbSNP:57119360
1336+g, tdbSNP:201309292
1389+dbSNP:
1389+c, gdbSNP:202207797
1400+a, gdbSNP:138974299
1425+c, tdbSNP:148524321
1426+a, gdbSNP:34625170
1438+c, tdbSNP:372487027
1439+a, gdbSNP:149255010
1454+a, gdbSNP:375627235
1460+c, tdbSNP:371136732
1462+a, gdbSNP:144591822
1484+c, tdbSNP:143841349
1487+a, gdbSNP:201906246
1502+c, tdbSNP:145309348
1507+a, gdbSNP:201152399
1508+c, tdbSNP:368368074
1509..1511+, gtgdbSNP:374724158
1520+c, tdbSNP:147606477
1541+c, tdbSNP:200242597
1542+a, gdbSNP:140632746
1552+c, tdbSNP:371176280
1615+a, tdbSNP:185563430
1627+c, tdbSNP:140517703
1632+a, gdbSNP:145469544
1633+a, gdbSNP:376636627
1639+a, gdbSNP:367593504
1679+c, tdbSNP:6658749
1707+c, tdbSNP:142302653
1778+dbSNP:
1778+c, tdbSNP:199587183
1782+a, gdbSNP:142161951
1865+c, gdbSNP:4381168
1882+a, gdbSNP:376621300
1901+a, gdbSNP:369745541
1936+a, gdbSNP:373615279
1947+c, tdbSNP:149729867
1968+a, gdbSNP:201491047
1976+g, tdbSNP:150391268
2043+a, gdbSNP:149574646
2073+c, gdbSNP:140095202
2129+a, c, gdbSNP:201653450
2177+a, gdbSNP:148576999
2192+c, tdbSNP:151131304
2201+dbSNP:
2201+c, tdbSNP:139036423
2217+a, gdbSNP:199627549
2244+c, tdbSNP:199657269
2282+c, tdbSNP:61789097
2285+a, gdbSNP:142086076
2297+g, tdbSNP:199908482
2343+dbSNP:
2343+a, tdbSNP:78836817
2344+c, tdbSNP:200013173
2383+g, tdbSNP:193251352
2399+c, tdbSNP:377481837
2400+a, g, tdbSNP:185204873
2419+a, gdbSNP:138633526
2423+a, gdbSNP:375576807
2430+a, gdbSNP:368223162
2433+c, tdbSNP:145914956
2447+c, tdbSNP:17036676
2448+a, gdbSNP:199967501
2486+c, tdbSNP:367733402
2518+c, tdbSNP:267597948
2520+a, gdbSNP:371795323
2544+a, gdbSNP:148070773
2546+a, gdbSNP:138851818
2592+a, gdbSNP:375995816
2597+c, tdbSNP:111289655
2639+dbSNP:
2639+g, tdbSNP:151162899
2645+c, tdbSNP:369397871
2646+a, gdbSNP:10801922
2648+c, tdbSNP:375551637
2659+c, tdbSNP:201017438
2736..2737+, gdbSNP:34483540
2736+c, gdbSNP:140355100
2748+c, tdbSNP:144307532
2751..2752+, gdbSNP:35699551
2770+c, tdbSNP:376114783
2785+a, cdbSNP:373026059
2808+a, gdbSNP:201831823
2960+c, tdbSNP:139077680
3048..3049+, adbSNP:3841437
3049..3050+, tdbSNP:386368175
3054..3055+, tdbSNP:386368176
3055..3056+, tdbSNP:386354261
3055..3056+, tdbSNP:397981446
3098+c, gdbSNP:112158356
3143+a, gdbSNP:149908791
3153+a, gdbSNP:55948695
3195+c, tdbSNP:201451440
complement(3270)-t, cdbSNP:74873663
3307+c, tdbSNP:371961603
3382..3383+, ttdbSNP:60366817
3382+, tdbSNP:72208816
3398..3400+, tttdbSNP:79031036
3410+c, tdbSNP:77794467
3415..3416+, cttdbSNP:374618885
3461+a, c, gdbSNP:3885
3477+a, gdbSNP:182232211
3482+a, gdbSNP:185887135
3665+a, gdbSNP:10801923
3695+c, tdbSNP:1127655
3699+c, tdbSNP:1127656
3713+a, gdbSNP:374154391
3775+c, tdbSNP:78586059
3809+a, gdbSNP:4620527
3915+c, tdbSNP:41275576
3959+a, gdbSNP:41275578
4055..4056+, cdbSNP:34107612
4228+c, tdbSNP:190396978
4253+c, gdbSNP:182591393
4301+a, cdbSNP:146769351
4310+a, gdbSNP:80348030
4368+, adbSNP:35107839
4421+c, tdbSNP:79753626
4489+c, tdbSNP:201309358
4515+c, tdbSNP:114176432
4545+c, tdbSNP:185607670
4574+a, gdbSNP:148872733
4623+c, tdbSNP:376460514
complement(4691)-t, cdbSNP:143565782
4735+a, gdbSNP:148040693
4808+a, gdbSNP:13951
4809+a, gdbSNP:74984838
4815+a, gdbSNP:77598758
4835+g, tdbSNP:201156901
4882..4883+, cdbSNP:34965021
4965+a, tdbSNP:57573398
5001+a, gdbSNP:386587403
complement(5001)-g, adbSNP:3829881
5099+a, gdbSNP:10923191
5223+a, gdbSNP:190026319
5343+c, tdbSNP:59226759
5467+c, tdbSNP:182764093
5479+a, gdbSNP:8254
5544+c, tdbSNP:187710236
complement(5560)-c, adbSNP:11836
5565+a, tdbSNP:150222246
5565+a, tdbSNP:386440081
5642+a, cdbSNP:200381206
complement(5650..5651)-t, cdbSNP:15885
5681+a, gdbSNP:138986752
5697+a, cdbSNP:78683029
5707+c, gdbSNP:193099815
5978+c, tdbSNP:1127215
5986+c, gdbSNP:944
6003+a, gdbSNP:143041827
6079+c, tdbSNP:6589
Gene SymbolPTGFRN
Gene SynonymCD315; CD9P-1; EWI-F; FPRP; SMAP-6
Chromosome1
Locus Map1p13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_020440 Homo sapiens prostaglandin F2 receptor inhibitor (PTGFRN), mRNA. In-stock $809.00 $760.00 15
Title CD9P-1 expression correlates with the metastatic status of lung cancer, and a truncated form of CD9P-1, GS-168AT2, inhibits in vivo tumour growth .
Author Guilmain W, Colin S, Legrand E, Vannier JP, Steverlynck C, Bongaerts M, Vasse M and Al-Mahmood S.
Journal Br. J. Cancer 104 (3), 496-504 (2011)
Title Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer .
Author Kerns SL, Ostrer H, Stock R, Li W, Moore J, Pearlman A, Campbell C, Shao Y, Stone N, Kusnetz L and Rosenstein BS.
Journal Int. J. Radiat. Oncol. Biol. Phys. 78 (5), 1292-1300 (2010)
Title Identification of novel candidate genes for treatment response to risperidone and susceptibility for schizophrenia: integrated analysis among pharmacogenomics, mouse expression, and genetic case-control association approaches .
Author Ikeda M, Tomita Y, Mouri A, Koga M, Okochi T, Yoshimura R, Yamanouchi Y, Kinoshita Y, Hashimoto R, Williams HJ, Takeda M, Nakamura J, Nabeshima T, Owen MJ, O'Donovan MC, Honda H, Arinami T, Ozaki N and Iwata N.
Journal Biol. Psychiatry 67 (3), 263-269 (2010)
Title In situ chemical cross-linking on living cells reveals CD9P-1 cis-oligomer at cell surface .
Author Andre M, Chambrion C, Charrin S, Soave S, Chaker J, Boucheix C, Rubinstein E and Le Naour F.
Journal J Proteomics 73 (1), 93-102 (2009)
Title Glycosylation status of the membrane protein CD9P-1 .
Author Andre M, Morelle W, Planchon S, Milhiet PE, Rubinstein E, Mollicone R, Chamot-Rooke J and Le Naour F.
Journal Proteomics 7 (21), 3880-3895 (2007)
Title The major CD9 and CD81 molecular partner. Identification and characterization of the complexes .
Author Charrin S, Le Naour F, Oualid M, Billard M, Faure G, Hanash SM, Boucheix C and Rubinstein E.
Journal J. Biol. Chem. 276 (17), 14329-14337 (2001)
Title FPRP, a major, highly stoichiometric, highly specific CD81- and CD9-associated protein .
Author Stipp CS, Orlicky D and Hemler ME.
Journal J. Biol. Chem. 276 (7), 4853-4862 (2001)
Title Synthesis and accumulation of a receptor regulatory protein associated with lipid droplet accumulation in 3T3-L1 cells .
Author Orlicky DJ, Lieber JG, Morin CL and Evans RM.
Journal J. Lipid Res. 39 (6), 1152-1161 (1998)
Title Human chromosome 1 localization of the gene for a prostaglandin F2alpha receptor negative regulatory protein .
Author Orlicky DJ, Berry R and Sikela JM.
Journal Hum. Genet. 97 (5), 655-658 (1996)
Title Negative regulatory activity of a prostaglandin F2 alpha receptor associated protein (FPRP) .
Author Orlicky DJ.
Journal Prostaglandins Leukot. Essent. Fatty Acids 54 (4), 247-259 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.