• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens prostaglandin F2 receptor inhibitor (PTGFRN), mRNA.


RefSeq Accession Definition Services Price Order
NM_020440 Homo sapiens prostaglandin F2 receptor inhibitor (PTGFRN), mRNA. ORF Sequence $765.60
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_020440.2, 41152505
Length 6160 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens prostaglandin F2 receptor inhibitor (PTGFRN), mRNA.
Product prostaglandin F2 receptor negative regulator precursor
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AB037857.1. On or before Jan 24, 2004 this sequence version replaced gi:41221584, gi:40538733.

RefSeq NP_065173.2
CDS 138..2777
Misc Feature(1)204..557
Misc Feature(2)225..557
Misc Feature(3)987..1265
Misc Feature(4)1407..1418
Misc Feature(5)2244..2252
Misc Feature(6)2634..2696
Exon (1)1..186
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Exon (2)187..555
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Exon (3)556..969
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Exon (4)970..1350
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Exon (5)1351..1776
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Exon (6)1777..2196
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Exon (7)2197..2304
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Exon (8)2305..2610
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Exon (9)2611..6160
Gene:PTGFRN
Gene Synonym:CD315; CD9P-1; EWI-F; FPRP; SMAP-6
Translation MGRLASRPLLLALLSLALCRGRVVRVPTATLVRVVGTELVIPCNVSDYDGPSEQNFDWSF SSLGSSFVELASTWEVGFPAQLYQERLQRGEILLRRTANDAVELHIKNVQPSDQGHYKCS TPSTDATVQGNYEDTVQVKVLADSLHVGPSARPPPSLSLREGEPFELRCTAASASPLHTH LALLWEVHRGPARRSVLALTHEGRFHPGLGYEQRYHSGDVRLDTVGSDAYRLSVSRALSA DQGSYRCIVSEWIAEQGNWQEIQEKAVEVATVVIQPSVLRAAVPKNVSVAEGKELDLTCN ITTDRADDVRPEVTWSFSRMPDSTLPGSRVLARLDRDSLVHSSPHVALSHVDARSYHLLV RDVSKENSGYYYCHVSLWAPGHNRSWHKVAEAVSSPAGVGVTWLEPDYQVYLNASKVPGF ADDPTELACRVVDTKSGEANVRFTVSWYYRMNRRSDNVVTSELLAVMDGDWTLKYGERSK QRAQDGDFIFSKEHTDTFNFRIQRTTEEDRGNYYCVVSAWTKQRNNSWVKSKDVFSKPVN IFWALEDSVLVVKARQPKPFFAAGNTFEMTCKVSSKNIKSPRYSVLIMAEKPVGDLSSPN ETKYIISLDQDSVVKLENWTDASRVDGVVLEKVQEDEFRYRMYQTQVSDAGLYRCMVTAW SPVRGSLWREAATSLSNPIEIDFQTSGPIFNASVHSDTPSVIRGDLIKLFCIITVEGAAL DPDDMAFDVSWFAVHSFGLDKAPVLLSSLDRKGIVTTSRRDWKSDLSLERVSVLEFLLQV HGSEDQDFGNYYCSVTPWVKSPTGSWQKEAEIHSKPVFITVKMDVLNAFKYPLLIGVGLS TVIGLLSCLIGYCSSHWCCKKEVQETRRERRRLMSMEMD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
181+c, gdbSNP:77292583
223+dbSNP:
223+c, tdbSNP:143995351
273+a, cdbSNP:150795856
281+c, tdbSNP:34531926
409+a, cdbSNP:201525760
415+c, tdbSNP:111346071
431+c, tdbSNP:77895792
434+c, gdbSNP:149801733
599+dbSNP:
599+a, gdbSNP:80123219
647+c, tdbSNP:148769134
822+a, gdbSNP:145790245
838+c, tdbSNP:143781613
862+a, gdbSNP:142424201
868+c, tdbSNP:188883808
888+c, gdbSNP:200993488
934+c, tdbSNP:137888350
965..966+at, gadbSNP:71483896
965+a, gdbSNP:10159095
966+a, tdbSNP:4546904
974+dbSNP:
974+a, gdbSNP:187821181
1040+c, tdbSNP:143073499
1055+c, tdbSNP:143746064
1070+c, tdbSNP:140719535
1078+c, tdbSNP:150849305
1107+a, tdbSNP:150028059
1127+g, tdbSNP:201270839
1134+c, tdbSNP:141382228
1135+a, gdbSNP:149030409
1165+c, tdbSNP:201175251
1218+c, tdbSNP:202082288
1223+g, tdbSNP:148214798
1263+g, tdbSNP:200214889
1278+a, gdbSNP:150341125
1280+a, gdbSNP:57119360
1336+g, tdbSNP:201309292
1389+dbSNP:
1389+c, gdbSNP:202207797
1400+a, gdbSNP:138974299
1425+c, tdbSNP:148524321
1426+a, gdbSNP:34625170
1439+a, gdbSNP:149255010
1462+a, gdbSNP:144591822
1484+c, tdbSNP:143841349
1487+a, gdbSNP:201906246
1502+c, tdbSNP:145309348
1507+a, gdbSNP:201152399
1520+c, tdbSNP:147606477
1541+c, tdbSNP:200242597
1542+a, gdbSNP:140632746
1615+a, tdbSNP:185563430
1627+c, tdbSNP:140517703
1632+a, gdbSNP:145469544
1679+c, tdbSNP:6658749
1707+c, tdbSNP:142302653
1778+dbSNP:
1778+c, tdbSNP:199587183
1782+a, gdbSNP:142161951
1865+c, gdbSNP:4381168
1947+c, tdbSNP:149729867
1968+a, gdbSNP:201491047
1976+g, tdbSNP:150391268
2043+a, gdbSNP:149574646
2073+c, gdbSNP:140095202
2129+a, gdbSNP:201653450
2177+a, gdbSNP:148576999
2192+c, tdbSNP:151131304
2201+dbSNP:
2201+c, tdbSNP:139036423
2217+a, gdbSNP:199627549
2244+c, tdbSNP:199657269
2282+c, tdbSNP:61789097
2285+a, gdbSNP:142086076
2297+g, tdbSNP:199908482
2343+dbSNP:
2343+a, tdbSNP:78836817
2344+c, tdbSNP:200013173
2383+g, tdbSNP:193251352
2400+a, g, tdbSNP:185204873
2419+a, gdbSNP:138633526
2433+c, tdbSNP:145914956
2447+c, tdbSNP:17036676
2448+a, gdbSNP:199967501
2544+a, gdbSNP:148070773
2546+a, gdbSNP:138851818
2597+c, tdbSNP:111289655
2639+dbSNP:
2639+g, tdbSNP:151162899
2646+a, gdbSNP:10801922
2659+c, tdbSNP:201017438
2736..2737+, gdbSNP:34483540
2736+c, gdbSNP:140355100
2748+c, tdbSNP:144307532
2751..2752+, gdbSNP:35699551
2808+a, gdbSNP:201831823
2960+c, tdbSNP:139077680
3047..3048+, adbSNP:3841437
3048..3049+, tdbSNP:67986355
3098+c, gdbSNP:112158356
3143+a, gdbSNP:149908791
3153+a, gdbSNP:55948695
3195+c, tdbSNP:201451440
3270+c, tdbSNP:74873663
3382..3384+, tttdbSNP:79031036
3382..3383+, t, ttdbSNP:60366817
3382+, t, ttdbSNP:72208816
3410+c, tdbSNP:77794467
3461+a, c, gdbSNP:3885
3477+a, gdbSNP:182232211
3482+a, gdbSNP:185887135
3665+a, gdbSNP:10801923
3695+c, tdbSNP:1127655
3699+c, tdbSNP:1127656
3775+c, tdbSNP:78586059
3809+a, gdbSNP:4620527
3915+c, tdbSNP:41275576
3959+a, gdbSNP:41275578
4055..4056+, cdbSNP:34107612
4228+c, tdbSNP:190396978
4253+c, gdbSNP:182591393
4301+a, cdbSNP:146769351
4310+a, gdbSNP:80348030
4368+, adbSNP:35107839
4421+c, tdbSNP:79753626
4489+c, tdbSNP:201309358
4515+c, tdbSNP:114176432
4545+c, tdbSNP:185607670
4574+a, gdbSNP:148872733
4691+c, tdbSNP:143565782
4735+a, gdbSNP:148040693
4808+a, gdbSNP:13951
4809+a, gdbSNP:74984838
4815+a, gdbSNP:77598758
4835+g, tdbSNP:201156901
4882..4883+, cdbSNP:34965021
4965+a, tdbSNP:57573398
5001+a, gdbSNP:3829881
5099+a, gdbSNP:10923191
5223+a, gdbSNP:190026319
5343+c, tdbSNP:59226759
5467+c, tdbSNP:182764093
5479+a, gdbSNP:8254
5544+c, tdbSNP:187710236
5560+a, cdbSNP:11836
5565+a, tdbSNP:150222246
5642+a, cdbSNP:200381206
5650..5651+c, tdbSNP:15885
5681+a, gdbSNP:138986752
5697+a, cdbSNP:78683029
5707+c, gdbSNP:193099815
5978+c, tdbSNP:1127215
5986+c, gdbSNP:944
6003+a, gdbSNP:143041827
6079+c, tdbSNP:6589
Gene SymbolPTGFRN
Gene SynonymCD315; CD9P-1; EWI-F; FPRP; SMAP-6
Chromosome1
Locus Map1p13.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_020440 Homo sapiens prostaglandin F2 receptor inhibitor (PTGFRN), mRNA. Full Length $2772.00
ORF Sequence $765.60
Title CD9P-1 expression correlates with the metastatic status of lung cancer, and a truncated form of CD9P-1, GS-168AT2, inhibits in vivo tumour growth .
Author Guilmain,W., Colin,S., Legrand,E., Vannier,J.P., Steverlynck,C., Bongaerts,M., Vasse,M. and Al-Mahmood,S.
Journal Br. J. Cancer 104 (3), 496-504 (2011)
Title Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer .
Author Kerns,S.L., Ostrer,H., Stock,R., Li,W., Moore,J., Pearlman,A., Campbell,C., Shao,Y., Stone,N., Kusnetz,L. and Rosenstein,B.S.
Journal Int. J. Radiat. Oncol. Biol. Phys. 78 (5), 1292-1300 (2010)
Title Identification of novel candidate genes for treatment response to risperidone and susceptibility for schizophrenia: integrated analysis among pharmacogenomics, mouse expression, and genetic case-control association approaches .
Author Ikeda,M., Tomita,Y., Mouri,A., Koga,M., Okochi,T., Yoshimura,R., Yamanouchi,Y., Kinoshita,Y., Hashimoto,R., Williams,H.J., Takeda,M., Nakamura,J., Nabeshima,T., Owen,M.J., O'Donovan,M.C., Honda,H., Arinami,T., Ozaki,N. and Iwata,N.
Journal Biol. Psychiatry 67 (3), 263-269 (2010)
Title In situ chemical cross-linking on living cells reveals CD9P-1 cis-oligomer at cell surface .
Author Andre,M., Chambrion,C., Charrin,S., Soave,S., Chaker,J., Boucheix,C., Rubinstein,E. and Le Naour,F.
Journal J Proteomics 73 (1), 93-102 (2009)
Title Glycosylation status of the membrane protein CD9P-1 .
Author Andre,M., Morelle,W., Planchon,S., Milhiet,P.E., Rubinstein,E., Mollicone,R., Chamot-Rooke,J. and Le Naour,F.
Journal Proteomics 7 (21), 3880-3895 (2007)
Title The major CD9 and CD81 molecular partner. Identification and characterization of the complexes .
Author Charrin,S., Le Naour,F., Oualid,M., Billard,M., Faure,G., Hanash,S.M., Boucheix,C. and Rubinstein,E.
Journal J. Biol. Chem. 276 (17), 14329-14337 (2001)
Title FPRP, a major, highly stoichiometric, highly specific CD81- and CD9-associated protein .
Author Stipp,C.S., Orlicky,D. and Hemler,M.E.
Journal J. Biol. Chem. 276 (7), 4853-4862 (2001)
Title Synthesis and accumulation of a receptor regulatory protein associated with lipid droplet accumulation in 3T3-L1 cells .
Author Orlicky,D.J., Lieber,J.G., Morin,C.L. and Evans,R.M.
Journal J. Lipid Res. 39 (6), 1152-1161 (1998)
Title Human chromosome 1 localization of the gene for a prostaglandin F2alpha receptor negative regulatory protein .
Author Orlicky,D.J., Berry,R. and Sikela,J.M.
Journal Hum. Genet. 97 (5), 655-658 (1996)
Title Negative regulatory activity of a prostaglandin F2 alpha receptor associated protein (FPRP) .
Author Orlicky,D.J.
Journal Prostaglandins Leukot. Essent. Fatty Acids 54 (4), 247-259 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878