• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha (NFKBIA), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19341 Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha (NFKBIA), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu19341C Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha (NFKBIA), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_020529.2, 168693660
Length 954 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha (NFKBIA), mRNA.
Product NF-kappa-B inhibitor alpha
Comment

Summary: This gene encodes a member of the NF-kappa-B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF-kappa-B/REL complexes which are involved in inflammatory responses. The encoded protein moves between the cytoplasm and the nucleus via a nuclear localization signal and CRM1-mediated nuclear export. Mutations in this gene have been found in ectodermal dysplasia anhidrotic with T-cell immunodeficiency autosomal dominant disease. [provided by RefSeq, Aug 2011].

RefSeq NP_065390.1
CDS 111..1064
Misc Feature(1)171..173
Misc Feature(2)171..173
Misc Feature(3)171..173
Misc Feature(4)174..176
Misc Feature(5)198..218
Misc Feature(6)204..206
Misc Feature(7)204..206
Misc Feature(8)204..206
Misc Feature(9)204..206
Misc Feature(10)204..206
Misc Feature(11)204..206
Misc Feature(12)216..218
Misc Feature(13)216..218
Misc Feature(14)216..218
Misc Feature(15)216..218
Misc Feature(16)216..218
Misc Feature(17)234..236
Misc Feature(18)234..236
Misc Feature(19)234..236
Misc Feature(20)234..236
Misc Feature(21)243..272
Misc Feature(22)327..419
Misc Feature(23)330..503
Misc Feature(24)423..821
Misc Feature(25)438..527
Misc Feature(26)438..470
Misc Feature(27)537..626
Misc Feature(28)552..848
Misc Feature(29)654..743
Misc Feature(30)738..740
Misc Feature(31)756..845
Misc Feature(32)840..842
Misc Feature(33)957..959
Misc Feature(34)957..959
Misc Feature(35)972..974
Misc Feature(36)972..974
Misc Feature(37)981..983
Misc Feature(38)981..983
Misc Feature(39)987..989
Misc Feature(40)987..989
Misc Feature(41)1005..1007
Exon (1)1..337
Gene:NFKBIA
Gene Synonym:IKBA; MAD-3; NFKBI
Exon (2)338..446
Gene:NFKBIA
Gene Synonym:IKBA; MAD-3; NFKBI
Exon (3)447..657
Gene:NFKBIA
Gene Synonym:IKBA; MAD-3; NFKBI
Exon (4)658..746
Gene:NFKBIA
Gene Synonym:IKBA; MAD-3; NFKBI
Exon (5)747..1016
Gene:NFKBIA
Gene Synonym:IKBA; MAD-3; NFKBI
Exon (6)1017..1567
Gene:NFKBIA
Gene Synonym:IKBA; MAD-3; NFKBI
Translation MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP RGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE DELPYDDCVFGGQRLTL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
25..26+dbSNP:
25..26+c, g, tdbSNP:11569615
25..26+, tgccgtccdbSNP:11569614
34..35+, ccgcccgcdbSNP:11569617
complement(45)-t, c, adbSNP:2273651
complement(49)-t, cdbSNP:368072323
77+a, gdbSNP:2233410
complement(105)-g, adbSNP:200864499
142+a, gdbSNP:121913664
150+g, tdbSNP:121913665
complement(186)-t, gdbSNP:200033269
188+a, gdbSNP:8192285
complement(191)-g, adbSNP:1957106
205+g, tdbSNP:28933100
complement(222)-t, gdbSNP:373643552
complement(266)-t, gdbSNP:369801548
complement(272)-g, adbSNP:138468321
complement(289)-g, adbSNP:371482940
complement(296)-g, adbSNP:143798499
complement(298)-g, adbSNP:376762724
complement(329)-g, adbSNP:371348054
complement(353)-dbSNP:
complement(353)-t, cdbSNP:2233412
complement(375)-g, adbSNP:201058640
392+c, tdbSNP:2233413
416+c, tdbSNP:1050851
complement(436)-t, cdbSNP:150221265
complement(478)-dbSNP:
complement(478)-t, cdbSNP:142422402
complement(489)-t, cdbSNP:377380656
complement(519)-g, adbSNP:147627228
complement(551)-g, adbSNP:375015401
complement(552)-g, adbSNP:371253544
complement(558)-g, adbSNP:377594611
complement(580)-g, adbSNP:372930764
complement(587)-t, g, adbSNP:199877737
complement(611)-g, adbSNP:200219960
complement(616)-g, adbSNP:151228045
complement(649)-t, gdbSNP:376763952
complement(664)-dbSNP:
complement(664)-g, adbSNP:142195196
complement(691)-g, cdbSNP:148656104
complement(751)-dbSNP:
complement(751)-g, adbSNP:373228608
complement(779)-t, gdbSNP:143869405
complement(830)-t, cdbSNP:369802093
complement(893)-t, gdbSNP:376370831
complement(901)-t, cdbSNP:149917774
complement(942)-t, gdbSNP:373499073
complement(997)-g, adbSNP:201191831
complement(998)-t, cdbSNP:139180460
complement(1013)-g, adbSNP:146132589
complement(1014)-t, cdbSNP:116801398
1039+dbSNP:
1039+c, tdbSNP:1803939
complement(1044..1045)-, gdbSNP:34378588
complement(1051)-t, cdbSNP:142970414
1066+c, tdbSNP:8904
complement(1067)-t, cdbSNP:368317245
complement(1068)-g, adbSNP:375907017
complement(1082)-g, cdbSNP:9333352
complement(1088)-t, cdbSNP:375256332
complement(1118)-g, adbSNP:191372109
1135+a, gdbSNP:1131420
complement(1138)-t, cdbSNP:138781182
complement(1140..1142)-, cttdbSNP:370364535
complement(1140..1141)-, tttdbSNP:200984079
complement(1142)-t, cdbSNP:149783842
complement(1145..1147)-, ttcdbSNP:145753299
complement(1145)-c, adbSNP:112369437
1151+a, tdbSNP:3209769
complement(1172)-g, cdbSNP:147363386
complement(1173)-g, adbSNP:142696288
1190+a, gdbSNP:696
complement(1207..1208)-, ttdbSNP:11569610
complement(1207..1208)-, ttdbSNP:386519561
complement(1222)-t, gdbSNP:187988391
complement(1240)-g, cdbSNP:45438895
complement(1259)-g, adbSNP:182929073
complement(1327)-t, gdbSNP:11569620
complement(1341)-t, gdbSNP:373095812
complement(1400)-c, adbSNP:113277534
complement(1485)-t, cdbSNP:2273650
complement(1497)-g, adbSNP:116765051
Gene SymbolNFKBIA
Gene SynonymIKBA; MAD-3; NFKBI
Chromosome14
Locus Map14q13
Title Ribosomal protein S3 interacts with the NF-kappaB inhibitor IkappaBalpha .
Author Stanborough T, Niederhauser J, Koch B, Bergler H and Pertschy B.
Journal FEBS Lett. 588 (5), 659-664 (2014)
Title The p97-UFD1L-NPL4 protein complex mediates cytokine-induced IkappaBalpha proteolysis .
Author Li JM, Wu H, Zhang W, Blackburn MR and Jin J.
Journal Mol. Cell. Biol. 34 (3), 335-347 (2014)
Title Direct observation of a transient ternary complex during IkappaBalpha-mediated dissociation of NF-kappaB from DNA .
Author Alverdi V, Hetrick B, Joseph S and Komives EA.
Journal Proc. Natl. Acad. Sci. U.S.A. 111 (1), 225-230 (2014)
Title Long-term incubation with proteasome inhibitors (PIs) induces IkappaBalpha degradation via the lysosomal pathway in an IkappaB kinase (IKK)-dependent and IKK-independent manner .
Author Lee KH, Jeong J and Yoo CG.
Journal J. Biol. Chem. 288 (45), 32777-32786 (2013)
Title Intracellular NF-kB-decrease and IKBalpha increase in human macrophages following CTLA4-Ig treatment .
Author Cutolo M, Soldano S, Contini P, Sulli A, Seriolo B, Montagna P and Brizzolara R.
Journal Clin. Exp. Rheumatol. 31 (6), 943-946 (2013)
Title Signal-induced degradation of I kappa B alpha requires site-specific ubiquitination .
Author Scherer DC, Brockman JA, Chen Z, Maniatis T and Ballard DW.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (24), 11259-11263 (1995)
Title I kappa B/MAD-3 masks the nuclear localization signal of NF-kappa B p65 and requires the transactivation domain to inhibit NF-kappa B p65 DNA binding .
Author Ganchi PA, Sun SC, Greene WC and Ballard DW.
Journal Mol. Biol. Cell 3 (12), 1339-1352 (1992)
Title Chromosomal localization of the genes encoding the p50/p105 subunits of NF-kappa B (NFKB2) and the I kappa B/MAD-3 (NFKBI) inhibitor of NF-kappa B to 4q24 and 14q13, respectively .
Author Le Beau MM, Ito C, Cogswell P, Espinosa R 3rd, Fernald AA and Baldwin AS Jr.
Journal Genomics 14 (2), 529-531 (1992)
Title Characterization of an immediate-early gene induced in adherent monocytes that encodes I kappa B-like activity .
Author Haskill S, Beg AA, Tompkins SM, Morris JS, Yurochko AD, Sampson-Johannes A, Mondal K, Ralph P and Baldwin AS Jr.
Journal Cell 65 (7), 1281-1289 (1991)
Title I kappa B: a specific inhibitor of the NF-kappa B transcription factor .
Author Baeuerle PA and Baltimore D.
Journal Science 242 (4878), 540-546 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.