• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha (NFKBIA), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_020529 Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha (NFKBIA), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_020529.2, 168693660
Length 1579 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha (NFKBIA), mRNA.
Product NF-kappa-B inhibitor alpha
Comment

Summary: This gene encodes a member of the NF-kappa-B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF-kappa-B/REL complexes which are involved in inflammatory responses. The encoded protein moves between the cytoplasm and the nucleus via a nuclear localization signal and CRM1-mediated nuclear export. Mutations in this gene have been found in ectodermal dysplasia anhidrotic with T-cell immunodeficiency autosomal dominant disease. [provided by RefSeq, Aug 2011].

RefSeq NP_065390.1
CDS 111..1064
Misc Feature(1)171..173
Misc Feature(2)171..173
Misc Feature(3)171..173
Misc Feature(4)174..176
Misc Feature(5)198..218
Misc Feature(6)204..206
Misc Feature(7)204..206
Misc Feature(8)204..206
Misc Feature(9)204..206
Misc Feature(10)204..206
Misc Feature(11)204..206
Misc Feature(12)216..218
Misc Feature(13)216..218
Misc Feature(14)216..218
Misc Feature(15)216..218
Misc Feature(16)216..218
Misc Feature(17)234..236
Misc Feature(18)234..236
Misc Feature(19)234..236
Misc Feature(20)234..236
Misc Feature(21)243..272
Misc Feature(22)327..419
Misc Feature(23)420..563
Misc Feature(24)423..821
Misc Feature(25)438..527
Misc Feature(26)438..470
Misc Feature(27)537..626
Misc Feature(28)552..848
Misc Feature(29)654..743
Misc Feature(30)738..740
Misc Feature(31)756..845
Misc Feature(32)840..842
Misc Feature(33)957..959
Misc Feature(34)957..959
Misc Feature(35)972..974
Misc Feature(36)972..974
Misc Feature(37)981..983
Misc Feature(38)981..983
Misc Feature(39)987..989
Misc Feature(40)987..989
Misc Feature(41)1005..1007
Exon (1)1..337
Gene:NFKBIA
Gene Synonym:IKBA; MAD-3; NFKBI
Exon (2)338..446
Gene:NFKBIA
Gene Synonym:IKBA; MAD-3; NFKBI
Exon (3)447..657
Gene:NFKBIA
Gene Synonym:IKBA; MAD-3; NFKBI
Exon (4)658..746
Gene:NFKBIA
Gene Synonym:IKBA; MAD-3; NFKBI
Exon (5)747..1016
Gene:NFKBIA
Gene Synonym:IKBA; MAD-3; NFKBI
Exon (6)1017..1567
Gene:NFKBIA
Gene Synonym:IKBA; MAD-3; NFKBI
Translation MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP RGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE DELPYDDCVFGGQRLTL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(25..26)-dbSNP:
complement(25..26)-t, g, cdbSNP:11569615
complement(25..26)-, tgccgtccdbSNP:11569614
complement(34..35)-, ccgcccgcdbSNP:11569617
complement(45)-t, c, adbSNP:2273651
complement(77)-g, adbSNP:2233410
complement(105)-g, adbSNP:200864499
complement(142)-g, adbSNP:121913664
complement(150)-t, gdbSNP:121913665
complement(186)-t, gdbSNP:200033269
complement(188)-g, adbSNP:8192285
complement(191)-g, adbSNP:1957106
complement(205)-t, gdbSNP:28933100
complement(272)-g, adbSNP:138468321
complement(296)-g, adbSNP:143798499
complement(353)-dbSNP:
complement(353)-t, cdbSNP:2233412
complement(375)-g, adbSNP:201058640
complement(392)-t, cdbSNP:2233413
complement(416)-t, cdbSNP:1050851
complement(436)-t, cdbSNP:150221265
complement(478)-dbSNP:
complement(478)-t, cdbSNP:142422402
complement(519)-g, adbSNP:147627228
complement(525)-g, adbSNP:145212029
complement(548)-g, adbSNP:141298006
complement(587)-g, adbSNP:199877737
complement(611)-g, adbSNP:200219960
complement(616)-g, adbSNP:151228045
complement(664)-dbSNP:
complement(664)-g, adbSNP:142195196
complement(691)-g, cdbSNP:148656104
complement(779)-dbSNP:
complement(779)-t, gdbSNP:143869405
complement(901)-t, cdbSNP:149917774
complement(997)-g, adbSNP:201191831
complement(998)-t, cdbSNP:139180460
complement(1013)-g, adbSNP:146132589
complement(1014)-t, cdbSNP:116801398
complement(1039)-dbSNP:
complement(1039)-t, cdbSNP:1803939
complement(1046..1047)-, gdbSNP:34378588
complement(1051)-t, cdbSNP:142970414
complement(1066)-t, cdbSNP:8904
complement(1082)-g, cdbSNP:9333352
complement(1118)-g, adbSNP:191372109
complement(1126..1127)-, ttcdbSNP:71714304
complement(1135)-g, adbSNP:1131420
complement(1138)-t, cdbSNP:138781182
complement(1140..1141)-, tttdbSNP:200984079
complement(1141..1143)-, cttdbSNP:72528317
complement(1141)-, aaadbSNP:11569608
complement(1142)-t, cdbSNP:149783842
complement(1145..1147)-, ttcdbSNP:145753299
complement(1145)-, aagdbSNP:70937093
complement(1145)-c, adbSNP:112369437
complement(1147)-, ttcdbSNP:3830964
complement(1151)-t, adbSNP:3209769
complement(1172)-g, cdbSNP:147363386
complement(1173)-g, adbSNP:142696288
complement(1190)-g, adbSNP:696
complement(1208..1209)-, ttdbSNP:11569610
complement(1222)-t, gdbSNP:187988391
complement(1240)-g, cdbSNP:45438895
complement(1259)-g, adbSNP:182929073
complement(1327)-t, gdbSNP:11569620
complement(1400)-c, adbSNP:113277534
complement(1485)-t, cdbSNP:2273650
complement(1497)-g, adbSNP:116765051
Gene SymbolNFKBIA
Gene SynonymIKBA; MAD-3; NFKBI
Chromosome14
Locus Map14q13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_020529 Homo sapiens nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha (NFKBIA), mRNA. In-stock $418.00 $369.00 10
Title Long-range effects and functional consequences of stabilizing mutations in the ankyrin repeat domain of IkappaBalpha .
Author Cervantes,C.F., Handley,L.D., Sue,S.C., Dyson,H.J. and Komives,E.A.
Journal J. Mol. Biol. 425 (5), 902-913 (2013)
Title Phosphorylation of IkappaBalpha at serine 32 by T-lymphokine-activated killer cell-originated protein kinase is essential for chemoresistance against doxorubicin in cervical cancer cells .
Author Park,J.H., Yoon,D.S., Choi,H.J., Hahm,D.H. and Oh,S.M.
Journal J. Biol. Chem. 288 (5), 3585-3593 (2013)
Title [Expressions of NF-kappaBp65 and IkappaBalpha in gestational trophoblastic disease and clinical significance] .
Author Ju,L.L., Liu,H.N., Cai,J.T. and Xu,J.
Journal Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi 28 (10), 1084-1087 (2012)
Title Altered IkappaBalpha expression promotes NF-kappaB activation in monocytes from primary Sjogren's syndrome patients .
Author Lisi,S., Sisto,M., Lofrumento,D.D. and D'Amore,M.
Journal Pathology 44 (6), 557-561 (2012)
Title Effects of NFKB1 and NFKBIA gene polymorphisms on susceptibility to environmental factors and the clinicopathologic development of oral cancer .
Author Lin,C.W., Hsieh,Y.S., Hsin,C.H., Su,C.W., Lin,C.H., Wei,L.H., Yang,S.F. and Chien,M.H.
Journal PLoS ONE 7 (4), E35078 (2012)
Title Signal-induced degradation of I kappa B alpha requires site-specific ubiquitination .
Author Scherer,D.C., Brockman,J.A., Chen,Z., Maniatis,T. and Ballard,D.W.
Journal Proc. Natl. Acad. Sci. U.S.A. 92 (24), 11259-11263 (1995)
Title I kappa B/MAD-3 masks the nuclear localization signal of NF-kappa B p65 and requires the transactivation domain to inhibit NF-kappa B p65 DNA binding .
Author Ganchi,P.A., Sun,S.C., Greene,W.C. and Ballard,D.W.
Journal Mol. Biol. Cell 3 (12), 1339-1352 (1992)
Title Chromosomal localization of the genes encoding the p50/p105 subunits of NF-kappa B (NFKB2) and the I kappa B/MAD-3 (NFKBI) inhibitor of NF-kappa B to 4q24 and 14q13, respectively .
Author Le Beau,M.M., Ito,C., Cogswell,P., Espinosa,R. III, Fernald,A.A. and Baldwin,A.S. Jr.
Journal Genomics 14 (2), 529-531 (1992)
Title Characterization of an immediate-early gene induced in adherent monocytes that encodes I kappa B-like activity .
Author Haskill,S., Beg,A.A., Tompkins,S.M., Morris,J.S., Yurochko,A.D., Sampson-Johannes,A., Mondal,K., Ralph,P. and Baldwin,A.S. Jr.
Journal Cell 65 (7), 1281-1289 (1991)
Title I kappa B: a specific inhibitor of the NF-kappa B transcription factor .
Author Baeuerle,P.A. and Baltimore,D.
Journal Science 242 (4878), 540-546 (1988)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.