Sequence in raw or FASTA format:
Homo sapiens reticulon 4 (RTN4), transcript variant 1, mRNA.
| RefSeq Version | NM_020532.4, 47519458 |
| Length | 4871 bp |
| Structure | linear |
| Update Date | 10-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens reticulon 4 (RTN4), transcript variant 1, mRNA. |
| Product | reticulon-4 isoform A |
| Comment | Summary: This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified. [provided by RefSeq]. Transcript Variant: This variant (1), also known as Nogo-A and RTN-XL, represents the longest transcript, and encodes the longest isoform (A). |
| RefSeq | NP_065393.1 |
| CDS | 299..3877 | Exon (1) | 1..854 | Exon (2) | 1..854 | Exon (3) | 855..911 | Exon (4) | 912..3311 | Exon (5) | 3312..3519 | Exon (6) | 3520..3658 | Exon (7) | 3659..3728 | Exon (8) | 3729..3775 | Exon (9) | 3776..3834 | Exon (10) | 3835..4844 |
| Translation | MEDLDQSPLVSSSDSPPRPQPAFKYQFVREPEDEEEEEEEEEEDEDEDLEELEVLERKPA
AGLSAAPVPTAPAAGAPLMDFGNDFVPPAPRGPLPAAPPVAPERQPSWDPSPVSSTVPAP
SPLSAAAVSPSKLPEDDEPPARPPPPPPASVSPQAEPVWTPPAPAPAAPPSTPAAPKRRG
SSGSVDETLFALPAASEPVIRSSAENMDLKEQPGNTISAGQEDFPSVLLETAASLPSLSP
LSAASFKEHEYLGNLSTVLPTEGTLQENVSEASKEVSEKAKTLLIDRDLTEFSELEYSEM
GSSFSVSPKAESAVIVANPREEIIVKNKDEEEKLVSNNILHNQQELPTALTKLVKEDEVV
SSEKAKDSFNEKRVAVEAPMREEYADFKPFERVWEVKDSKEDSDMLAAGGKIESNLESKV
DKKCFADSLEQTNHEKDSESSNDDTSFPSTPEGIKDRSGAYITCAPFNPAATESIATNIF
PLLGDPTSENKTDEKKIEEKKAQIVTEKNTSTKTSNPFLVAAQDSETDYVTTDNLTKVTE
EVVANMPEGLTPDLVQEACESELNEVTGTKIAYETKMDLVQTSEVMQESLYPAAQLCPSF
EESEATPSPVLPDIVMEAPLNSAVPSAGASVIQPSSSPLEASSVNYESIKHEPENPPPYE
EAMSVSLKKVSGIKEEIKEPENINAALQETEAPYISIACDLIKETKLSAEPAPDFSDYSE
MAKVEQPVPDHSELVEDSSPDSEPVDLFSDDSIPDVPQKQDETVMLVKESLTETSFESMI
EYENKEKLSALPPEGGKPYLESFKLSLDNTKDTLLPDEVSTLSKKEKIPLQMEELSTAVY
SNDDLFISKEAQIRETETFSDSSPIEIIDEFPTLISSKTDSFSKLAREYTDLEVSHKSEI
ANAPDGAGSLPCTELPHDLSLKNIQPKVEEKISFSDDFSKNGSATSKVLLLPPDVSALAT
QAEIESIVKPKVLVKEAEKKLPSDTEKEDRSPSAIFSAELSKTSVVDLLYWRDIKKTGVV
FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESE
VAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTL
LILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(23) | - | t, c | dbSNP:2241958 |
| complement(94) | - | g, c | dbSNP:6545468 |
| complement(192) | - | g, c | dbSNP:115712308 |
| complement(198) | - | c, a | dbSNP:73936817 |
| complement(247) | - | t, c | dbSNP:111973909 |
| complement(509) | - | t, c | dbSNP:117465650 |
| complement(527) | - | g, c | dbSNP:72912589 |
| complement(856) | - | g, a | dbSNP:116154853 |
| complement(1368) | - | t, a | dbSNP:11677099 |
| complement(1473) | - | t, c | dbSNP:74974792 |
| complement(1617) | - | t, c | dbSNP:79528680 |
| complement(1647) | - | g, a | dbSNP:72912565 |
| complement(1774) | - | g, a | dbSNP:115896469 |
| complement(1820) | - | t, c | dbSNP:112462695 |
| complement(2115) | - | g, a | dbSNP:75722875 |
| complement(2156) | - | g, a | dbSNP:79560160 |
| complement(2164) | - | c, a | dbSNP:112683861 |
| complement(2376) | - | g, a | dbSNP:80228408 |
| complement(2473) | - | t, g | dbSNP:117828716 |
| complement(2685) | - | t, c | dbSNP:75633313 |
| complement(2738) | - | t, g | dbSNP:80121116 |
| complement(2993) | - | g, c | dbSNP:6757519 |
| 3007 | + | c, g | dbSNP:1048202 |
| complement(3057) | - | g, c | dbSNP:6757705 |
| complement(3069) | - | g, a | dbSNP:78408943 |
| complement(3119) | - | t, g | dbSNP:115518597 |
| complement(3274) | - | t, c | dbSNP:111958278 |
| 3493 | + | a, g | dbSNP:3916038 |
| complement(3507) | - | g, c | dbSNP:11549898 |
| 3908 | + | a, c | dbSNP:1801912 |
| 3957 | + | c, t | dbSNP:1801911 |
| complement(4082) | - | g, a | dbSNP:11549897 |
| complement(4088) | - | g, a | dbSNP:7588687 |
| complement(4121..4124) | - | , atag | dbSNP:10610251 |
| complement(4121..4122) | - | , tagat | dbSNP:71682890 |
| complement(4123) | - | t, a | dbSNP:74991306 |
| complement(4124) | - | g, a | dbSNP:76019495 |
| complement(4127..4130) | - | , agat | dbSNP:67682513 |
| complement(4220..4221) | - | , t | dbSNP:71739567 |
| complement(4221..4222) | - | , t | dbSNP:36163297 |
| complement(4221) | - | t, c | dbSNP:115748648 |
| complement(4230..4231) | - | , tt | dbSNP:71729728 |
| complement(4231..4232) | - | , tt | dbSNP:71739774 |
| complement(4236..4237) | - | , t | dbSNP:35013297 |
| complement(4237..4238) | - | , t | dbSNP:11464312 |
| complement(4238) | - | t, c | dbSNP:116351311 |
| complement(4321) | - | t, c | dbSNP:17046520 |
| complement(4405) | - | t, c | dbSNP:7573286 |
| complement(4605..4606) | - | , ttg | dbSNP:71700301 |
| complement(4606..4607) | - | , ttg | dbSNP:34917480 |
| complement(4607..4608) | - | , ttg | dbSNP:72536027 |
| complement(4610..4611) | - | , tgt | dbSNP:34606720 |
| complement(4611..4612) | - | , tgt | dbSNP:5831331 |
| complement(4612) | - | t, a | dbSNP:77225605 |
| complement(4659) | - | c, a | dbSNP:15028 |
| complement(4670) | - | g, a | dbSNP:112785682 |
| complement(4727) | - | t, a | dbSNP:15029 |
| complement(4818) | - | t, c | dbSNP:112105650 |
| Gene Symbol | RTN4 |
| Gene Synonym | ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C |
| Chromosome | 2 |
| Locus Map | 2p16.3 |
| All Transcripts | NM_020532 , NM_207520 , NM_153828 , NM_007008 , NM_207521 |
| Title | Endothelial reticulon-4B (Nogo-B) regulates ICAM-1-mediated leukocyte transmigration and acute inflammation . |
| Author | Di Lorenzo,A., Manes,T.D., Davalos,A., Wright,P.L. and Sessa,W.C. |
| Journal | Blood 117 (7), 2284-2295 (2011) |
| Title | Identification and regulation of reticulon 4B (Nogo-B) in renal tubular epithelial cells . |
| Author | Marin,E.P., Moeckel,G., Al-Lamki,R., Bradley,J., Yan,Q., Wang,T., Wright,P.L., Yu,J. and Sessa,W.C. |
| Journal | Am. J. Pathol. 177 (6), 2765-2773 (2010) |
| Title | Epithelial reticulon 4B (Nogo-B) is an endogenous regulator of Th2-driven lung inflammation . |
| Author | Wright,P.L., Yu,J., Di,Y.P., Homer,R.J., Chupp,G., Elias,J.A., Cohn,L. and Sessa,W.C. |
| Journal | J. Exp. Med. 207 (12), 2595-2607 (2010) |
| Title | RTN3 and RTN4: Candidate modulators in vascular cell apoptosis and atherosclerosis . |
| Author | Chen,Y., Zhao,S. and Xiang,R. |
| Journal | J. Cell. Biochem. 111 (4), 797-800 (2010) |
| Title | Dendritic spine alterations in neocortical pyramidal neurons following postnatal neuronal Nogo-A knockdown . |
| Author | Pradhan,A.D., Case,A.M., Farrer,R.G., Tsai,S.Y., Cheatwood,J.L., Martin,J.L. and Kartje,G.L. |
| Journal | Dev. Neurosci. 32 (4), 313-320 (2010) |
| Title | A novel protein, RTN-XS, interacts with both Bcl-XL and Bcl-2 on endoplasmic reticulum and reduces their anti-apoptotic activity . |
| Author | Tagami,S., Eguchi,Y., Kinoshita,M., Takeda,M. and Tsujimoto,Y. |
| Journal | Oncogene 19 (50), 5736-5746 (2000) |
| Title | Identification of the Nogo inhibitor of axon regeneration as a Reticulon protein . |
| Author | GrandPre,T., Nakamura,F., Vartanian,T. and Strittmatter,S.M. |
| Journal | Nature 403 (6768), 439-444 (2000) |
| Title | Nogo-A is a myelin-associated neurite outgrowth inhibitor and an antigen for monoclonal antibody IN-1 . |
| Author | Chen,M.S., Huber,A.B., van der Haar,M.E., Frank,M., Schnell,L., Spillmann,A.A., Christ,F. and Schwab,M.E. |
| Journal | Nature 403 (6768), 434-439 (2000) |
| Title | Inhibitor of neurite outgrowth in humans . |
| Author | Prinjha,R., Moore,S.E., Vinson,M., Blake,S., Morrow,R., Christie,G., Michalovich,D., Simmons,D.L. and Walsh,F.S. |
| Journal | Nature 403 (6768), 383-384 (2000) |
| Title | Assignment of the human reticulon 4 gene (RTN4) to chromosome 2p14-->2p13 by radiation hybrid mapping . |
| Author | Yang,J., Yu,L., Bi,A.D. and Zhao,S.Y. |
| Journal | Cytogenet. Cell Genet. 88 (1-2), 101-102 (2000) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |