• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens reticulon 4 (RTN4), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_020532 Homo sapiens reticulon 4 (RTN4), transcript variant 1, mRNA. ORF Sequence $1252.65
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_020532.4, 47519458
Length 4871 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens reticulon 4 (RTN4), transcript variant 1, mRNA.
Product reticulon-4 isoform A
Comment

Summary: This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1), also known as Nogo-A and RTN-XL, represents the longest transcript, and encodes the longest isoform (A).

RefSeq NP_065393.1
CDS 299..3877
Misc Feature(1)173..175
Misc Feature(2)299..301
Misc Feature(3)299..301
Misc Feature(4)317..319
Misc Feature(5)317..319
Misc Feature(6)329..331
Misc Feature(7)335..337
Misc Feature(8)341..343
Misc Feature(9)341..343
Misc Feature(10)617..619
Misc Feature(11)617..619
Misc Feature(12)839..841
Misc Feature(13)839..841
Misc Feature(14)842..844
Misc Feature(15)848..850
Misc Feature(16)860..862
Misc Feature(17)884..886
Misc Feature(18)2876..2878
Misc Feature(19)2885..2887
Misc Feature(20)3311..3823
Misc Feature(21)3353..3415
Misc Feature(22)3608..3610
Misc Feature(23)3698..3760
Exon (1)1..854
Gene:RTN4
Gene Synonym:ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C
Exon (2)855..911
Gene:RTN4
Gene Synonym:ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C
Exon (3)912..3311
Gene:RTN4
Gene Synonym:ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C
Exon (4)3312..3519
Gene:RTN4
Gene Synonym:ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C
Exon (5)3520..3658
Gene:RTN4
Gene Synonym:ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C
Exon (6)3659..3728
Gene:RTN4
Gene Synonym:ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C
Exon (7)3729..3775
Gene:RTN4
Gene Synonym:ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C
Exon (8)3776..3834
Gene:RTN4
Gene Synonym:ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C
Exon (9)3835..4844
Gene:RTN4
Gene Synonym:ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C
Translation MEDLDQSPLVSSSDSPPRPQPAFKYQFVREPEDEEEEEEEEEEDEDEDLEELEVLERKPA AGLSAAPVPTAPAAGAPLMDFGNDFVPPAPRGPLPAAPPVAPERQPSWDPSPVSSTVPAP SPLSAAAVSPSKLPEDDEPPARPPPPPPASVSPQAEPVWTPPAPAPAAPPSTPAAPKRRG SSGSVDETLFALPAASEPVIRSSAENMDLKEQPGNTISAGQEDFPSVLLETAASLPSLSP LSAASFKEHEYLGNLSTVLPTEGTLQENVSEASKEVSEKAKTLLIDRDLTEFSELEYSEM GSSFSVSPKAESAVIVANPREEIIVKNKDEEEKLVSNNILHNQQELPTALTKLVKEDEVV SSEKAKDSFNEKRVAVEAPMREEYADFKPFERVWEVKDSKEDSDMLAAGGKIESNLESKV DKKCFADSLEQTNHEKDSESSNDDTSFPSTPEGIKDRSGAYITCAPFNPAATESIATNIF PLLGDPTSENKTDEKKIEEKKAQIVTEKNTSTKTSNPFLVAAQDSETDYVTTDNLTKVTE EVVANMPEGLTPDLVQEACESELNEVTGTKIAYETKMDLVQTSEVMQESLYPAAQLCPSF EESEATPSPVLPDIVMEAPLNSAVPSAGASVIQPSSSPLEASSVNYESIKHEPENPPPYE EAMSVSLKKVSGIKEEIKEPENINAALQETEAPYISIACDLIKETKLSAEPAPDFSDYSE MAKVEQPVPDHSELVEDSSPDSEPVDLFSDDSIPDVPQKQDETVMLVKESLTETSFESMI EYENKEKLSALPPEGGKPYLESFKLSLDNTKDTLLPDEVSTLSKKEKIPLQMEELSTAVY SNDDLFISKEAQIRETETFSDSSPIEIIDEFPTLISSKTDSFSKLAREYTDLEVSHKSEI ANAPDGAGSLPCTELPHDLSLKNIQPKVEEKISFSDDFSKNGSATSKVLLLPPDVSALAT QAEIESIVKPKVLVKEAEKKLPSDTEKEDRSPSAIFSAELSKTSVVDLLYWRDIKKTGVV FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESE VAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTL LILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(10)-dbSNP:
complement(10)-g, adbSNP:201667382
complement(17)-g, adbSNP:200830338
complement(21)-t, cdbSNP:199717670
complement(23)-t, cdbSNP:2241958
complement(41)-t, adbSNP:200499432
complement(46)-g, cdbSNP:199647682
complement(51)-g, cdbSNP:201153187
complement(53)-g, cdbSNP:200505922
complement(54)-g, adbSNP:199823391
complement(62)-g, adbSNP:201370633
complement(67)-t, gdbSNP:200413227
complement(71)-t, cdbSNP:202126097
complement(72)-g, cdbSNP:201173248
complement(75)-t, cdbSNP:200177765
complement(77)-g, adbSNP:202011860
complement(81)-c, adbSNP:201233137
complement(86)-t, cdbSNP:200086156
complement(94)-g, cdbSNP:6545468
complement(97)-t, cdbSNP:200975003
complement(123)-c, adbSNP:200030571
complement(124)-g, adbSNP:201523254
complement(132)-g, adbSNP:200672709
complement(167)-g, adbSNP:199510455
complement(182)-g, adbSNP:201374998
complement(192)-g, cdbSNP:115712308
complement(198)-c, adbSNP:73936817
complement(203)-g, adbSNP:201758339
complement(209)-t, adbSNP:200224613
complement(211)-g, adbSNP:199620531
complement(239)-g, adbSNP:201396177
complement(240)-g, cdbSNP:200417238
complement(247)-t, cdbSNP:111973909
complement(293)-g, cdbSNP:202179239
complement(320)-g, adbSNP:201003451
complement(332)-g, adbSNP:200419663
complement(413)-t, cdbSNP:202099851
complement(421)-t, gdbSNP:200758158
complement(441)-t, adbSNP:201394469
complement(482)-t, cdbSNP:190624391
complement(509)-t, cdbSNP:117465650
complement(526)-t, cdbSNP:202244693
complement(527)-g, cdbSNP:72912589
complement(565)-c, adbSNP:200273488
complement(570)-t, cdbSNP:201598949
complement(807)-t, gdbSNP:200650924
complement(833)-t, cdbSNP:185564856
complement(836)-t, cdbSNP:192552854
complement(840)-g, adbSNP:200934135
complement(856)-dbSNP:
complement(856)-g, adbSNP:116154853
complement(873)-g, adbSNP:199947972
complement(906)-g, cdbSNP:201780227
complement(921)-dbSNP:
complement(921)-t, adbSNP:142927672
complement(952)-t, cdbSNP:138402788
complement(958)-c, adbSNP:201481421
complement(973)-t, cdbSNP:200377322
complement(990)-g, adbSNP:201534077
complement(991)-c, adbSNP:202219919
complement(993)-t, gdbSNP:139005709
complement(1001)-g, adbSNP:201178485
complement(1017)-g, cdbSNP:200186382
complement(1027)-g, adbSNP:202014771
complement(1028)-t, cdbSNP:200040850
complement(1037)-t, cdbSNP:200103838
complement(1079)-t, cdbSNP:201887472
complement(1102)-g, adbSNP:201104714
complement(1107)-g, cdbSNP:199922298
complement(1108)-g, adbSNP:201526211
complement(1110)-t, gdbSNP:142346020
complement(1113)-t, gdbSNP:200673304
complement(1116)-t, gdbSNP:199517493
complement(1153)-t, cdbSNP:201379656
complement(1154)-g, cdbSNP:200715212
complement(1161)-t, cdbSNP:199715715
complement(1180)-t, cdbSNP:150314957
complement(1204)-t, cdbSNP:140323493
complement(1206)-g, adbSNP:143123978
complement(1213)-g, adbSNP:201207744
complement(1220)-g, cdbSNP:199609007
complement(1238)-t, cdbSNP:144622313
complement(1253)-t, gdbSNP:200420602
complement(1259)-t, cdbSNP:147697322
complement(1269)-t, adbSNP:139293680
complement(1271)-t, cdbSNP:200885212
complement(1274)-t, cdbSNP:142398245
complement(1301)-g, cdbSNP:200400496
complement(1313)-t, cdbSNP:202210731
complement(1368)-t, adbSNP:11677099
complement(1374)-g, adbSNP:199844556
complement(1376)-t, cdbSNP:201745078
complement(1437)-t, g, adbSNP:146974947
complement(1444)-g, cdbSNP:200087263
complement(1459)-g, cdbSNP:201600114
complement(1473)-t, cdbSNP:74974792
complement(1475)-g, cdbSNP:199928140
complement(1477)-t, adbSNP:202005074
complement(1481)-t, cdbSNP:200826553
complement(1499)-t, cdbSNP:199523418
complement(1518)-g, adbSNP:201293234
complement(1525)-t, adbSNP:200611126
complement(1545)-c, adbSNP:150153229
complement(1552)-g, adbSNP:147000793
complement(1553)-t, cdbSNP:142353497
complement(1567)-t, cdbSNP:148965039
complement(1600)-t, g, adbSNP:149825421
complement(1617)-t, cdbSNP:79528680
complement(1646)-t, gdbSNP:201992311
complement(1647)-g, adbSNP:72912565
complement(1664)-c, adbSNP:148639122
complement(1668)-t, cdbSNP:143644566
complement(1674)-t, cdbSNP:201924791
complement(1675)-t, cdbSNP:200772365
complement(1680)-t, cdbSNP:200006889
complement(1703)-g, cdbSNP:200756281
complement(1723)-c, adbSNP:141357857
complement(1727)-t, cdbSNP:146977729
complement(1738)-c, adbSNP:201813514
complement(1753)-t, adbSNP:201239793
complement(1769)-t, cdbSNP:199848386
complement(1774)-g, adbSNP:115896469
complement(1779)-t, cdbSNP:200836354
complement(1820)-t, cdbSNP:112462695
complement(1825)-g, adbSNP:201160413
complement(1827)-g, adbSNP:186442295
complement(1835)-t, cdbSNP:200005008
complement(1842)-g, adbSNP:201513834
complement(1848)-g, cdbSNP:201909156
complement(1877)-t, cdbSNP:200507839
complement(1880)-c, adbSNP:180697740
complement(1924)-g, adbSNP:138638032
complement(1933)-g, adbSNP:140420673
complement(1997)-t, cdbSNP:199619012
complement(2050)-t, gdbSNP:201574587
complement(2055)-t, adbSNP:200830017
complement(2069)-t, adbSNP:199824937
complement(2092)-t, cdbSNP:201374523
complement(2102)-g, cdbSNP:200272918
complement(2107)-t, cdbSNP:151278910
complement(2115)-g, adbSNP:75722875
complement(2117)-g, adbSNP:201245422
complement(2149)-t, cdbSNP:200209057
complement(2151)-g, adbSNP:201728566
complement(2156)-g, adbSNP:79560160
complement(2164)-c, adbSNP:112683861
complement(2179)-c, adbSNP:199541230
complement(2188)-g, adbSNP:200488094
complement(2191)-c, adbSNP:202247736
complement(2197)-t, cdbSNP:200977252
complement(2203)-g, adbSNP:199938038
complement(2204)-g, adbSNP:201783314
complement(2206)-t, adbSNP:200292355
complement(2220)-g, cdbSNP:201139274
complement(2257)-c, adbSNP:199852595
complement(2267)-g, adbSNP:145842142
complement(2268)-t, gdbSNP:200840660
complement(2281)-t, cdbSNP:199677856
complement(2283)-g, adbSNP:202070632
complement(2285)-t, cdbSNP:201681804
complement(2303)-t, cdbSNP:200464710
complement(2330)-t, gdbSNP:199659586
complement(2331)-t, cdbSNP:201155529
complement(2350)-g, adbSNP:200366005
complement(2376)-g, adbSNP:80228408
complement(2387)-t, cdbSNP:201019792
complement(2392)-t, cdbSNP:199830409
complement(2414)-t, cdbSNP:201377879
complement(2432)-g, cdbSNP:200421222
complement(2436)-g, adbSNP:202240754
complement(2437)-t, cdbSNP:201182840
complement(2471)-t, g, cdbSNP:147845919
complement(2473)-t, gdbSNP:202017809
complement(2494)-g, adbSNP:200016041
complement(2498)-g, cdbSNP:145160466
complement(2512)-g, cdbSNP:201002601
complement(2518)-g, adbSNP:200085728
complement(2519)-t, cdbSNP:139542847
complement(2533)-g, adbSNP:148273185
complement(2543)-t, gdbSNP:200011211
complement(2554)-t, cdbSNP:201782105
complement(2555)-t, cdbSNP:200674381
complement(2563)-g, adbSNP:199526754
complement(2574)-t, cdbSNP:143205997
complement(2581)-g, adbSNP:201358364
complement(2582)-g, cdbSNP:200560723
complement(2589)-t, adbSNP:199710712
complement(2639)-t, cdbSNP:201729254
complement(2649)-t, cdbSNP:149032297
complement(2653)-g, cdbSNP:199612143
complement(2655)-t, cdbSNP:201417469
complement(2666)-t, cdbSNP:201916819
complement(2668)-c, adbSNP:200376263
complement(2680)-g, cdbSNP:201853000
complement(2706)-g, adbSNP:201298021
complement(2715)-g, cdbSNP:200432869
complement(2738)-t, gdbSNP:80121116
complement(2769)-t, cdbSNP:201310203
complement(2776)-t, cdbSNP:151330533
complement(2841)-g, cdbSNP:144867063
complement(2843)-t, cdbSNP:202189185
complement(2854)-t, cdbSNP:200170159
complement(2859)-g, cdbSNP:145018115
complement(2869)-t, cdbSNP:199864046
complement(2872)-t, cdbSNP:147365678
complement(2881)-g, adbSNP:200776112
complement(2882)-t, adbSNP:139555612
complement(2891)-t, cdbSNP:200053000
complement(2917)-t, cdbSNP:201610878
complement(2921)-t, cdbSNP:200454950
complement(2928)-g, cdbSNP:199983655
complement(2934)-g, cdbSNP:201785748
complement(2948)-t, cdbSNP:200955027
complement(2972)-t, gdbSNP:199778380
complement(2993)-g, cdbSNP:6757519
complement(3005)-t, cdbSNP:200686106
complement(3007)-g, cdbSNP:1048202
complement(3010)-t, c, adbSNP:142717278
complement(3012)-t, cdbSNP:199642899
complement(3033)-g, cdbSNP:201479450
complement(3057)-g, cdbSNP:6757705
complement(3061)-t, cdbSNP:202192262
complement(3067)-g, adbSNP:181216175
complement(3069)-g, adbSNP:78408943
complement(3086)-t, cdbSNP:201027753
complement(3096)-c, adbSNP:200793021
complement(3100)-g, cdbSNP:200009407
complement(3119)-t, gdbSNP:115518597
complement(3132)-g, adbSNP:141079866
complement(3144)-t, c, adbSNP:199869997
complement(3145)-g, cdbSNP:201878803
complement(3146)-g, adbSNP:200413257
complement(3165)-g, adbSNP:200670524
complement(3179)-g, cdbSNP:146701040
complement(3183)-g, adbSNP:199645396
complement(3184)-t, cdbSNP:201924443
complement(3188)-t, cdbSNP:200503618
complement(3199)-t, cdbSNP:199592685
complement(3205)-t, cdbSNP:201421748
complement(3212)-t, cdbSNP:200950640
complement(3239)-g, adbSNP:199774136
complement(3248)-t, cdbSNP:145032505
complement(3250)-c, adbSNP:201732018
complement(3272)-t, g, adbSNP:139414628
complement(3274)-t, cdbSNP:111958278
complement(3280)-g, adbSNP:199769551
complement(3281)-t, cdbSNP:201229603
complement(3299)-t, cdbSNP:200210000
complement(3325)-dbSNP:
complement(3325)-g, cdbSNP:201579187
complement(3356)-t, cdbSNP:146295139
complement(3389)-g, adbSNP:200580708
complement(3394)-t, cdbSNP:200331222
complement(3395)-g, cdbSNP:199774793
complement(3402)-t, cdbSNP:201543611
complement(3413)-t, cdbSNP:200640197
complement(3417)-g, adbSNP:199605350
complement(3425)-t, adbSNP:201611899
complement(3429)-g, adbSNP:200372740
complement(3473)-t, c, adbSNP:148322379
complement(3481)-g, cdbSNP:201294855
complement(3493)-g, adbSNP:3916038
complement(3506)-g, cdbSNP:143366666
complement(3507)-g, cdbSNP:11549898
complement(3543)-dbSNP:
complement(3543)-t, g, cdbSNP:147780849
complement(3545)-t, cdbSNP:200090073
complement(3601)-g, adbSNP:140801868
complement(3603)-g, adbSNP:142622923
complement(3614)-g, adbSNP:200453121
complement(3620)-g, adbSNP:199900368
complement(3632)-g, cdbSNP:202003557
complement(3687)-dbSNP:
complement(3687)-t, cdbSNP:201476146
complement(3706)-g, adbSNP:146763580
complement(3742)-dbSNP:
complement(3742)-g, cdbSNP:201797895
complement(3758)-t, cdbSNP:201008627
complement(3768)-t, cdbSNP:199865440
complement(3782)-dbSNP:
complement(3782)-t, gdbSNP:201377396
complement(3791)-g, adbSNP:200435777
complement(3848)-dbSNP:
complement(3848)-t, gdbSNP:201754765
complement(3849)-t, adbSNP:200869264
complement(3853)-c, adbSNP:200464998
complement(3863)-g, adbSNP:200000051
complement(3864)-t, cdbSNP:202245854
complement(3874)-t, cdbSNP:145269375
complement(3906)-t, cdbSNP:200991383
complement(3908)-c, adbSNP:1801912
complement(3919)-t, gdbSNP:199985801
complement(3936)-g, adbSNP:182249122
complement(3947)-g, cdbSNP:201181001
complement(3957)-t, cdbSNP:1801911
complement(3959)-t, cdbSNP:201650264
complement(3966)-t, gdbSNP:200843623
complement(3968)-t, cdbSNP:199709210
complement(3981)-g, adbSNP:202045881
complement(3991)-t, cdbSNP:192549959
complement(4017)-t, cdbSNP:199657090
complement(4043)-c, adbSNP:201164478
complement(4053)-g, adbSNP:200317855
complement(4054)-t, c, adbSNP:199847182
complement(4065)-t, adbSNP:188462887
complement(4076)-c, adbSNP:200432386
complement(4082)-g, adbSNP:11549897
complement(4085)-g, cdbSNP:202063048
complement(4088)-g, adbSNP:7588687
complement(4099)-t, cdbSNP:200233791
complement(4102)-g, adbSNP:202026081
complement(4103)-g, adbSNP:200990119
complement(4104)-t, c, adbSNP:144089719
complement(4112)-t, adbSNP:201926579
complement(4113)-g, adbSNP:200937046
complement(4120)-g, adbSNP:199980877
complement(4121)-g, adbSNP:201782299
complement(4122)-t, adbSNP:200951696
complement(4124)-g, adbSNP:200154708
complement(4125..4128)-, atagdbSNP:10610251
complement(4126..4127)-, tagatdbSNP:71682890
complement(4127..4130)-, agatdbSNP:67682513
complement(4127)-t, cdbSNP:199722940
complement(4128)-t, adbSNP:200580165
complement(4174)-g, cdbSNP:199772340
complement(4176)-g, cdbSNP:201723114
complement(4187)-g, adbSNP:200588879
complement(4221)-t, cdbSNP:199976185
complement(4222)-t, cdbSNP:201468708
complement(4231)-t, gdbSNP:200371104
complement(4236..4237)-, t, ttdbSNP:35013297
complement(4237..4238)-, tdbSNP:11464312
complement(4238)-t, g, cdbSNP:202185654
complement(4241)-g, adbSNP:201291673
complement(4248)-t, cdbSNP:139348498
complement(4252)-t, cdbSNP:202059591
complement(4269)-g, adbSNP:201348166
complement(4270)-t, cdbSNP:146272136
complement(4277)-g, adbSNP:202160819
complement(4280)-t, cdbSNP:201066308
complement(4297)-g, adbSNP:200083970
complement(4302)-g, adbSNP:201606813
complement(4315)-t, cdbSNP:200450825
complement(4319)-c, adbSNP:199954596
complement(4321)-t, cdbSNP:17046520
complement(4325)-g, adbSNP:200950289
complement(4342)-g, adbSNP:199772258
complement(4357)-c, adbSNP:201485833
complement(4376)-t, adbSNP:192029683
complement(4405)-t, cdbSNP:7573286
complement(4411)-t, cdbSNP:199696847
complement(4418)-g, adbSNP:201472280
complement(4420)-t, cdbSNP:200177668
complement(4455)-g, cdbSNP:202189971
complement(4470)-t, gdbSNP:201429489
complement(4473)-g, adbSNP:200490276
complement(4474)-g, cdbSNP:202172363
complement(4475)-t, adbSNP:200786732
complement(4485)-t, cdbSNP:199962317
complement(4558)-t, cdbSNP:201797502
complement(4569)-t, cdbSNP:201002014
complement(4598)-t, cdbSNP:187115076
complement(4603)-t, cdbSNP:199894370
complement(4606..4607)-, ttgdbSNP:34917480
complement(4606)-t, gdbSNP:201860840
complement(4607..4608)-, ttgdbSNP:72536027
complement(4608..4609)-, ttgdbSNP:71700301
complement(4610..4611)-, tgtdbSNP:34606720
complement(4611..4612)-, tgtdbSNP:5831331
complement(4611)-t, cdbSNP:201065668
complement(4612)-t, adbSNP:77225605
complement(4636)-t, cdbSNP:201859368
complement(4646)-t, adbSNP:200495895
complement(4659)-c, adbSNP:15028
complement(4663)-t, cdbSNP:201778140
complement(4667)-g, cdbSNP:200735755
complement(4670)-g, adbSNP:112785682
complement(4675)-g, adbSNP:201479931
complement(4681)-g, adbSNP:200412179
complement(4683)-t, cdbSNP:199679501
complement(4687)-g, adbSNP:201226133
complement(4697)-t, adbSNP:200204309
complement(4699..4700)-, caaadbSNP:142955736
complement(4702)-t, cdbSNP:201749822
complement(4713)-t, adbSNP:200867834
complement(4718)-t, cdbSNP:200486941
complement(4720)-g, cdbSNP:202170586
complement(4721)-g, adbSNP:201045670
complement(4724)-c, adbSNP:199905587
complement(4727)-t, adbSNP:15029
complement(4729)-t, adbSNP:201176170
complement(4740)-t, cdbSNP:200115437
complement(4753)-c, adbSNP:201647512
complement(4773)-t, adbSNP:200686138
complement(4785)-g, adbSNP:199734477
complement(4788)-g, cdbSNP:201852360
complement(4790)-t, cdbSNP:200640111
complement(4802)-t, cdbSNP:199604209
complement(4818)-t, cdbSNP:112105650
complement(4824)-t, cdbSNP:200314378
complement(4829)-g, cdbSNP:199845070
complement(4841)-t, gdbSNP:201062310
complement(4844)-t, cdbSNP:200336343
Gene SymbolRTN4
Gene SynonymASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C
Chromosome2
Locus Map2p16.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_007008 Homo sapiens reticulon 4 (RTN4), transcript variant 3, mRNA. Full Length $524.32
ORF Sequence $174.00
NM_020532 Homo sapiens reticulon 4 (RTN4), transcript variant 1, mRNA. Full Length $1704.85
ORF Sequence $1252.65
NM_153828 Homo sapiens reticulon 4 (RTN4), transcript variant 2, mRNA. Full Length $700.06
ORF Sequence $325.38
NM_207520 Homo sapiens reticulon 4 (RTN4), transcript variant 4, mRNA. Full Length $716.59
ORF Sequence $341.91
NM_207521 Homo sapiens reticulon 4 (RTN4), transcript variant 5, mRNA. Full Length $1445.15
ORF Sequence $858.69
Title Genetic variation in RTN4 3'-UTR and susceptibility to cervical squamous cell carcinoma .
Author Shi,S., Zhou,B., Wang,Y., Chen,Y., Zhang,K., Wang,K., Quan,Y., Song,Y., Rao,L. and Zhang,L.
Journal DNA Cell Biol. 31 (6), 1088-1094 (2012)
Title RNT4 3'-UTR insertion/deletion polymorphisms are not associated with atrial septal defect in Chinese Han population: a brief communication .
Author Li,H., Chen,Y., Zhou,B., Peng,Y., Bai,W. and Rao,L.
Journal DNA Cell Biol. 31 (6), 1121-1124 (2012)
Title Nogo-A: a useful marker for the diagnosis of oligodendroglioma and for identifying 1p19q codeletion .
Author Marucci,G., Di Oto,E., Farnedi,A., Panzacchi,R., Ligorio,C. and Foschini,M.P.
Journal Hum. Pathol. 43 (3), 374-380 (2012)
Title Nogo receptor 3, a paralog of Nogo-66 receptor 1 (NgR1), may function as a NgR1 co-receptor for Nogo-66 .
Author Zhang,L., Kuang,X. and Zhang,J.
Journal J Genet Genomics 38 (11), 515-523 (2011)
Title The role of Nogo and the mitochondria-endoplasmic reticulum unit in pulmonary hypertension .
Author Sutendra,G., Dromparis,P., Wright,P., Bonnet,S., Haromy,A., Hao,Z., McMurtry,M.S., Michalak,M., Vance,J.E., Sessa,W.C. and Michelakis,E.D.
Journal Sci Transl Med 3 (88), 88RA55 (2011)
Title A novel protein, RTN-XS, interacts with both Bcl-XL and Bcl-2 on endoplasmic reticulum and reduces their anti-apoptotic activity .
Author Tagami,S., Eguchi,Y., Kinoshita,M., Takeda,M. and Tsujimoto,Y.
Journal Oncogene 19 (50), 5736-5746 (2000)
Title Identification of the Nogo inhibitor of axon regeneration as a Reticulon protein .
Author GrandPre,T., Nakamura,F., Vartanian,T. and Strittmatter,S.M.
Journal Nature 403 (6768), 439-444 (2000)
Title Nogo-A is a myelin-associated neurite outgrowth inhibitor and an antigen for monoclonal antibody IN-1 .
Author Chen,M.S., Huber,A.B., van der Haar,M.E., Frank,M., Schnell,L., Spillmann,A.A., Christ,F. and Schwab,M.E.
Journal Nature 403 (6768), 434-439 (2000)
Title Inhibitor of neurite outgrowth in humans .
Author Prinjha,R., Moore,S.E., Vinson,M., Blake,S., Morrow,R., Christie,G., Michalovich,D., Simmons,D.L. and Walsh,F.S.
Journal Nature 403 (6768), 383-384 (2000)
Title Assignment of the human reticulon 4 gene (RTN4) to chromosome 2p14-->2p13 by radiation hybrid mapping .
Author Yang,J., Yu,L., Bi,A.D. and Zhao,S.Y.
Journal Cytogenet. Cell Genet. 88 (1-2), 101-102 (2000)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878