• THAT   AND
  • THAT   AND


Homo sapiens growth differentiation factor 3 (GDF3), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_020634 Homo sapiens growth differentiation factor 3 (GDF3), mRNA. Full Lenth $354.96
ORF Sequence $317.55


RefSeq Version NM_020634.1, 10190669
Length 1224 bp
Structure linear
Update Date 09-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens growth differentiation factor 3 (GDF3), mRNA.
Product growth/differentiation factor 3 precursor
Comment

Summary: The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. [provided by RefSeq].

RefSeq NP_065685.1
CDS 37..1131
Exon (1)1..304
Exon (2)1..304
Exon (3)305..1224
Translation MLRFLPDLAFSFLLILALGQAVQFQEYVFLQFLGLDKAPSPQKFQPVPYILKKIFQDREA AATTGVSRDLCYVKELGVRGNVLRFLPDQGFFLYPKKISQASSCLQKLLYFNLSAIKERE QLTLAQLGLDLGPNSYYNLGPELELALFLVQEPHVWGQTTPKPGKMFVLRSVPWPQGAVH FNLLDVAKDWNDNPRKNFGLFLEILVKEDRDSGVNFQPEDTCARLRCSLHASLLVVTLNP DQCHPSRKRRAAIPVPKLSCKNLCHRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFS LTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVDE CGCG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(159)-g, cdbSNP:17727707
complement(619)-g, adbSNP:112895783
complement(673)-t, cdbSNP:12819884
complement(1018)-g, cdbSNP:2302516
Gene SymbolGDF3
Gene SynonymKFS3; MCOP7; MCOPCB6
Chromosome12
Locus Map12p13.1
All Transcripts NM_020634
Title Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study .
Author Flachsbart,F., Franke,A., Kleindorp,R., Caliebe,A., Blanche,H., Schreiber,S. and Nebel,A.
Journal Mutat. Res. 694 (1-2), 13-19 (2010)
Title A large-scale candidate gene association study of age at menarche and age at natural menopause .
Author He,C., Kraft,P., Chasman,D.I., Buring,J.E., Chen,C., Hankinson,S.E., Pare,G., Chanock,S., Ridker,P.M. and Hunter,D.J.
Journal Hum. Genet. 128 (5), 515-527 (2010)
Title New genetic associations detected in a host response study to hepatitis B vaccine .
Author Davila,S., Froeling,F.E., Tan,A., Bonnard,C., Boland,G.J., Snippe,H., Hibberd,M.L. and Seielstad,M.
Journal Genes Immun. 11 (3), 232-238 (2010)
Title Mutation of the bone morphogenetic protein GDF3 causes ocular and skeletal anomalies .
Author Ye,M., Berry-Wynne,K.M., Asai-Coakwell,M., Sundaresan,P., Footz,T., French,C.R., Abitbol,M., Fleisch,V.C., Corbett,N., Allison,W.T., Drummond,G., Walter,M.A., Underhill,T.M., Waskiewicz,A.J. and Lehmann,O.J.
Journal Hum. Mol. Genet. 19 (2), 287-298 (2010)
Title Testicular mixed germ cell tumors: a morphological and immunohistochemical study using stem cell markers, OCT3/4, SOX2 and GDF3, with emphasis on morphologically difficult-to-classify areas .
Author Gopalan,A., Dhall,D., Olgac,S., Fine,S.W., Korkola,J.E., Houldsworth,J., Chaganti,R.S., Bosl,G.J., Reuter,V.E. and Tickoo,S.K.
Journal Mod. Pathol. 22 (8), 1066-1074 (2009)
Title Expression pattern of growth/differentiation factor 3 in human and murine cerebral cortex, hippocampus as well as cerebellum .
Author Hexige,S., Guo,J., Ma,L., Sun,Y., Liu,X., Ma,L., Yan,X., Li,Z. and Yu,L.
Journal Neurosci. Lett. 389 (2), 83-87 (2005)
Title The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment .
Author Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J., Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B., Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E., Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S., Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C., Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V., Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K., Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z., Goddard,A., Wood,W.I., Godowski,P. and Gray,A.
Journal Genome Res. 13 (10), 2265-2270 (2003)
Title The family of bone morphogenetic proteins .
Author Ducy,P. and Karsenty,G.
Journal Kidney Int. 57 (6), 2207-2214 (2000)
Title Human growth-differentiation factor 3 (hGDF3): developmental regulation in human teratocarcinoma cell lines and expression in primary testicular germ cell tumours .
Author Caricasole,A.A., van Schaik,R.H., Zeinstra,L.M., Wierikx,C.D., van Gurp,R.J., van den Pol,M., Looijenga,L.H., Oosterhuis,J.W., Pera,M.F., Ward,A., de Bruijn,D., Kramer,P., de Jong,F.H. and van den Eijnden-van Raaij,A.J.
Journal Oncogene 16 (1), 95-103 (1998)
Title GDF-3 and GDF-9: two new members of the transforming growth factor-beta superfamily containing a novel pattern of cysteines .
Author McPherron,A.C. and Lee,S.J.
Journal J. Biol. Chem. 268 (5), 3444-3449 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878