• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens growth differentiation factor 3 (GDF3), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_020634 Homo sapiens growth differentiation factor 3 (GDF3), mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_020634.1, 10190669
Length 1224 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens growth differentiation factor 3 (GDF3), mRNA.
Product growth/differentiation factor 3 precursor
Comment

Summary: The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. [provided by RefSeq, Jul 2008].

RefSeq NP_065685.1
CDS 37..1131
Misc Feature(1)103..747
Misc Feature(2)826..1128
Exon (1)1..304
Gene:GDF3
Gene Synonym:KFS3; MCOP7; MCOPCB6
Exon (2)305..1224
Gene:GDF3
Gene Synonym:KFS3; MCOP7; MCOPCB6
Translation MLRFLPDLAFSFLLILALGQAVQFQEYVFLQFLGLDKAPSPQKFQPVPYILKKIFQDREA AATTGVSRDLCYVKELGVRGNVLRFLPDQGFFLYPKKISQASSCLQKLLYFNLSAIKERE QLTLAQLGLDLGPNSYYNLGPELELALFLVQEPHVWGQTTPKPGKMFVLRSVPWPQGAVH FNLLDVAKDWNDNPRKNFGLFLEILVKEDRDSGVNFQPEDTCARLRCSLHASLLVVTLNP DQCHPSRKRRAAIPVPKLSCKNLCHRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFS LTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVDE CGCG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(13)-dbSNP:
complement(13)-g, cdbSNP:201794479
complement(17)-g, adbSNP:201617669
complement(19)-t, gdbSNP:202105265
complement(93)-g, adbSNP:144267553
complement(150)-t, cdbSNP:144330834
complement(159)-g, cdbSNP:17727707
complement(188)-g, adbSNP:146378324
complement(217)-c, adbSNP:142236459
complement(373)-dbSNP:
complement(373)-g, adbSNP:148657137
complement(382)-t, cdbSNP:150698698
complement(515)-t, gdbSNP:199585440
complement(516)-g, adbSNP:141133108
complement(517)-g, adbSNP:148203165
complement(545)-c, adbSNP:145849916
complement(570)-g, adbSNP:200893461
complement(603)-g, adbSNP:185665015
complement(615)-g, adbSNP:144017935
complement(619)-g, adbSNP:112895783
complement(620)-t, cdbSNP:146973734
complement(673)-t, cdbSNP:12819884
complement(678)-t, cdbSNP:149033500
complement(699)-g, adbSNP:145601141
complement(776)-t, cdbSNP:150170520
complement(832)-g, adbSNP:140926412
complement(833)-t, cdbSNP:188391724
complement(838)-g, adbSNP:200736960
complement(912)-g, adbSNP:146197089
complement(1018)-g, cdbSNP:2302516
complement(1131)-t, cdbSNP:184349554
Gene SymbolGDF3
Gene SynonymKFS3; MCOP7; MCOPCB6
Chromosome12
Locus Map12p13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_020634 Homo sapiens growth differentiation factor 3 (GDF3), mRNA. In-stock $418.00 $369.00 10
Title Regulation of human growth and differentiation factor 3 gene expression by NANOG in human embryonic carcinoma NCCIT cells .
Author Park,S.W., Lim,H.Y., Do,H.J., Sung,B., Huh,S.H., Uhm,S.J., Song,H., Chung,H.J., Kim,J.H., Kim,N.H. and Kim,J.H.
Journal FEBS Lett. 586 (19), 3529-3535 (2012)
Title GDF3 inhibits the growth of breast cancer cells and promotes the apoptosis induced by Taxol .
Author Li,Q., Ling,Y. and Yu,L.
Journal J. Cancer Res. Clin. Oncol. 138 (6), 1073-1079 (2012)
Title Growth differentiation factor 3 is induced by bone morphogenetic protein 6 (BMP-6) and BMP-7 and increases luteinizing hormone receptor messenger RNA expression in human granulosa cells .
Author Shi,J., Yoshino,O., Osuga,Y., Akiyama,I., Harada,M., Koga,K., Fujimoto,A., Yano,T. and Taketani,Y.
Journal Fertil. Steril. 97 (4), 979-983 (2012)
Title The conditioned medium from a stable human GDF3-expressing CHO cell line, induces the differentiation of PC12 cells .
Author Li,Q., Liu,X., Wu,Y., An,J., Hexige,S., Ling,Y., Zhang,M., Yang,X. and Yu,L.
Journal Mol. Cell. Biochem. 359 (1-2), 115-123 (2012)
Title Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study .
Author Flachsbart,F., Franke,A., Kleindorp,R., Caliebe,A., Blanche,H., Schreiber,S. and Nebel,A.
Journal Mutat. Res. 694 (1-2), 13-19 (2010)
Title Expression pattern of growth/differentiation factor 3 in human and murine cerebral cortex, hippocampus as well as cerebellum .
Author Hexige,S., Guo,J., Ma,L., Sun,Y., Liu,X., Ma,L., Yan,X., Li,Z. and Yu,L.
Journal Neurosci. Lett. 389 (2), 83-87 (2005)
Title The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment .
Author Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J., Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B., Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E., Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S., Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C., Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V., Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K., Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z., Goddard,A., Wood,W.I., Godowski,P. and Gray,A.
Journal Genome Res. 13 (10), 2265-2270 (2003)
Title The family of bone morphogenetic proteins .
Author Ducy,P. and Karsenty,G.
Journal Kidney Int. 57 (6), 2207-2214 (2000)
Title Human growth-differentiation factor 3 (hGDF3): developmental regulation in human teratocarcinoma cell lines and expression in primary testicular germ cell tumours .
Author Caricasole,A.A., van Schaik,R.H., Zeinstra,L.M., Wierikx,C.D., van Gurp,R.J., van den Pol,M., Looijenga,L.H., Oosterhuis,J.W., Pera,M.F., Ward,A., de Bruijn,D., Kramer,P., de Jong,F.H. and van den Eijnden-van Raaij,A.J.
Journal Oncogene 16 (1), 95-103 (1998)
Title GDF-3 and GDF-9: two new members of the transforming growth factor-beta superfamily containing a novel pattern of cysteines .
Author McPherron,A.C. and Lee,S.J.
Journal J. Biol. Chem. 268 (5), 3444-3449 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.