• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens UV-stimulated scaffold protein A (UVSSA), mRNA.


RefSeq Accession Definition Services Price Order
NM_020894 Homo sapiens UV-stimulated scaffold protein A (UVSSA), mRNA. ORF Sequence $617.70
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_020894.2, 190358542
Length 4665 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens UV-stimulated scaffold protein A (UVSSA), mRNA.
Product UV-stimulated scaffold protein A
Comment

Summary: The protein encoded by this gene appears to be involved in ubiquitination and dephosphorylation of RNA polymerase II subunits that stall after UV irradiation. The encoded protein interacts with several members of the nucleotide excision repair complex to help repair UV-induced DNA damage. Defects in this gene can cause UV-sensitive syndrome 3. [provided by RefSeq, May 2012].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.


##Evidence-Data-START## Transcript exon combination :: AB040963.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_065945.2
CDS 448..2577
Misc Feature(1)<188..>188
Misc Feature(2)190..192
Misc Feature(3)451..882
Misc Feature(4)451..882
Misc Feature(5)1288..1290
Misc Feature(6)1306..1308
Misc Feature(7)1930..2262
Exon (1)1..445
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (2)446..545
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (3)546..876
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (4)877..997
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (5)998..1381
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (6)1382..1494
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (7)1495..1623
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (8)1624..1735
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (9)1736..1880
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (10)1881..2015
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (11)2016..2199
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (12)2200..2308
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (13)2309..2483
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (14)2484..4665
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Translation MDQKLSKLVEELTTSGEPRLNPEKMKELKKICKSSEEQLSRAYRLLIAQLTQEHAEIRLS AFQIVEELFVRSHQFRMLVVSNFQEFLELTLGTDPAQPLPPPREAAQRLRQATTRAVEGW NEKFGEAYKKLALGYHFLRHNKKVDFQDTNARSLAERKREEEKQKHLDKIYQERASQAER EMQEMSGEIESCLTEVESCFRLLVPFDFDPNPETESLGMASGMSDALRSSCAGQVGPCRS GTPDPRDGEQPCCSRDLPASAGHPRAGGGAQPSQTATGDPSDEDEDSDLEEFVRSHGLGS HKYTLDVELCSEGLKVQENEDNLALIHAARDTLKLIRNKFLPAVCSWIQRFTRVGTHGGC LKRAIDLKAELELVLRKYKELDIEPEGGERRRTEALGDAEEDEDDEDFVEVPEKEGYEPH IPDHLRPEYGLEAAPEKDTVVRCLRTRTRMDEEVSDPTSAAAQLRQLRDHLPPPSSASPS RALPEPQEAQKLAAERARAPVVPYGVDLHYWGQELPTAGKIVKSDSQHRFWKPSEVEEEV VNADISEMLRSRHITFAGKFEPVQHWCRAPRPDGRLCERQDRLKCPFHGKIVPRDDEGRP LDPEDRAREQRRQLQKQERPEWQDPELMRDVEAATGQDLGSSRYSGKGRGKKRRYPSLTN LKAQADTARARIGRKVFAKAAVRRVVAAMNRMDQKKHEKFSNQFNYALN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
163+dbSNP:
163+c, tdbSNP:139033323
188+a, gdbSNP:71614967
196+a, gdbSNP:13146729
307+g, tdbSNP:116170374
464+c, tdbSNP:138607842
475+a, gdbSNP:149266206
502+c, tdbSNP:199574083
503+a, gdbSNP:116804738
528+a, gdbSNP:139446068
548+dbSNP:
548+c, tdbSNP:144988532
558+g, tdbSNP:139792832
570+c, tdbSNP:62000970
575+a, gdbSNP:201659434
604+c, gdbSNP:140162022
610+a, gdbSNP:200842541
618+c, tdbSNP:143918768
639+c, tdbSNP:2276903
652+g, tdbSNP:200608307
655+g, tdbSNP:151085866
659+a, gdbSNP:200262507
705+c, gdbSNP:182881806
724+a, gdbSNP:199918903
746+c, tdbSNP:201608727
755+a, gdbSNP:141069322
761+c, tdbSNP:200196963
762+a, gdbSNP:149796000
781+a, gdbSNP:145739457
785+a, cdbSNP:140611637
790+c, tdbSNP:145622542
796+a, gdbSNP:201486316
800+a, tdbSNP:200231004
836+a, gdbSNP:112417076
891+dbSNP:
891+a, cdbSNP:138228745
901+c, tdbSNP:141095512
911+c, tdbSNP:201414673
931+a, gdbSNP:200745723
943+a, cdbSNP:200811036
951+a, tdbSNP:200163688
971+c, tdbSNP:143198789
981+a, gdbSNP:201407968
1019+dbSNP:
1019+a, cdbSNP:200478324
1024+c, tdbSNP:148246275
1028+c, tdbSNP:141286641
1060+a, cdbSNP:150774883
1072+g, tdbSNP:137963993
1076+c, tdbSNP:143547791
1077+a, gdbSNP:147131553
1083+a, gdbSNP:77892061
1088+c, tdbSNP:150060662
1089+a, gdbSNP:144411768
1129+c, tdbSNP:148799777
1140+c, tdbSNP:115978884
1143+a, gdbSNP:146853550
1154+c, gdbSNP:201508186
1163+a, gdbSNP:140577099
1183+c, tdbSNP:144329202
1184+a, gdbSNP:76217876
1248+c, tdbSNP:182834064
1270+a, gdbSNP:200874287
1308+c, tdbSNP:146539928
1309+a, gdbSNP:141268114
1314+c, tdbSNP:200424814
1315+a, gdbSNP:199781120
1324+a, gdbSNP:150164998
1327+c, tdbSNP:145597820
1336+a, gdbSNP:148904487
1398+dbSNP:
1398+g, tdbSNP:12644923
1429+a, gdbSNP:143536293
1431+c, tdbSNP:138129709
1432+g, tdbSNP:188017443
1435+c, tdbSNP:143509490
1436+a, gdbSNP:201333426
1437+c, tdbSNP:145897251
1440+c, tdbSNP:149078829
1441+a, gdbSNP:138649386
1452+c, tdbSNP:141128227
1456+c, tdbSNP:113866137
1461+c, tdbSNP:184622678
1473+a, gdbSNP:139957083
1481+g, tdbSNP:149434443
1507+dbSNP:
1507+a, gdbSNP:138618709
1510+a, gdbSNP:116741007
1529+g, tdbSNP:201115491
1534+c, tdbSNP:139719436
1536+c, tdbSNP:144288420
1577+a, gdbSNP:200309770
1596+c, tdbSNP:146589878
1619+a, gdbSNP:2276904
1656+dbSNP:
1656+a, gdbSNP:200469736
1660+a, gdbSNP:142249516
1710+c, gdbSNP:184668136
1713+c, tdbSNP:151254049
1714+c, gdbSNP:140365902
1723+c, tdbSNP:201394250
1762+dbSNP:
1762+a, cdbSNP:147019484
1780+c, tdbSNP:147609449
1790+c, tdbSNP:201913293
1808+g, tdbSNP:142208115
1811+c, tdbSNP:202127588
1833+c, tdbSNP:145972793
1834+c, tdbSNP:138697244
1841+a, gdbSNP:200830830
1844..1845+, gdbSNP:138106588
1849+c, tdbSNP:201031469
1850+a, gdbSNP:149276991
1854+c, tdbSNP:143426578
1864+, cdbSNP:35031262
1869+c, tdbSNP:71606322
1893+dbSNP:
1893+a, gdbSNP:114098503
1929+a, gdbSNP:147989651
1939+c, tdbSNP:141563406
1940+a, gdbSNP:146406848
1944+a, gdbSNP:11724369
1951+a, gdbSNP:192415191
1992+c, tdbSNP:142916158
2001+c, tdbSNP:146124669
2017+dbSNP:
2017+c, tdbSNP:111846369
2018+c, tdbSNP:200573569
2076+c, gdbSNP:199552593
2077+a, gdbSNP:200658998
2086+g, tdbSNP:190971132
2095+c, tdbSNP:139749595
2109+c, tdbSNP:149802815
2118+c, tdbSNP:200505151
2158+a, gdbSNP:145701437
2167+a, gdbSNP:182731155
2181+a, gdbSNP:148515747
2185+a, cdbSNP:144530948
2227+dbSNP:
2227+a, cdbSNP:28614045
2240+a, gdbSNP:142276654
2246+c, tdbSNP:77731309
2255+c, tdbSNP:193009688
2257+c, gdbSNP:199921553
2269+c, tdbSNP:201799212
2276+a, gdbSNP:151199613
2278+c, tdbSNP:140176848
2301+a, gdbSNP:115722661
2306+c, tdbSNP:28522910
2338+dbSNP:
2338+c, gdbSNP:140839981
2370+a, gdbSNP:9996817
2380+a, gdbSNP:201318732
2382+c, tdbSNP:138454833
2396+g, tdbSNP:200802210
2399+a, gdbSNP:143086848
2403+a, gdbSNP:146112543
2434+a, gdbSNP:148359793
2454+c, tdbSNP:141457671
2455+a, gdbSNP:150863986
2478+c, tdbSNP:199557939
2479+a, gdbSNP:139310992
2500+dbSNP:
2500+c, gdbSNP:187456912
2509+a, gdbSNP:145324347
2519+a, gdbSNP:147251189
2539+a, gdbSNP:140574139
2565+c, tdbSNP:144550138
2568+a, c, gdbSNP:145552493
2579+a, gdbSNP:148888724
2629+c, gdbSNP:149418525
2796+c, tdbSNP:183282542
2856+a, gdbSNP:144791465
2861+a, gdbSNP:6838561
2880+c, tdbSNP:114225009
2893+a, gdbSNP:116475969
2937+c, tdbSNP:116685682
2986+c, tdbSNP:78986148
3029+c, gdbSNP:75400033
3083+, cdbSNP:150381588
3168+c, gdbSNP:62284756
3233+c, tdbSNP:142884195
3266+a, gdbSNP:78117292
3333..3334+, t, ttdbSNP:113822553
3333+g, tdbSNP:200546473
3334..3335+, t, ttdbSNP:35810542
3341..3342+, t, ttdbSNP:56335346
3342+g, tdbSNP:13122610
3527+a, gdbSNP:4974558
3676+a, gdbSNP:4974559
3734+a, gdbSNP:140801789
3796+c, tdbSNP:111610721
3829..3830+, tdbSNP:34554552
3839+a, gdbSNP:147863813
3841+a, gdbSNP:192085591
3844+c, tdbSNP:184680283
3850+c, tdbSNP:188243543
3892+c, tdbSNP:192528919
3894+a, gdbSNP:13123788
3909+a, gdbSNP:111792007
3941+c, tdbSNP:13125500
3981+c, tdbSNP:184955128
4037+a, gdbSNP:12640103
4093+c, tdbSNP:10678
4101+g, tdbSNP:189067218
4172+a, gdbSNP:61694619
4243+g, tdbSNP:9603
4295+c, tdbSNP:145575243
4333+a, gdbSNP:180958717
4339+a, gdbSNP:148884141
4401+a, gdbSNP:143542918
4409+c, gdbSNP:184657776
4501+g, tdbSNP:200556028
4548+c, tdbSNP:137960699
4560+a, cdbSNP:75915160
4626+a, gdbSNP:1137789
4652+a, cdbSNP:142451255
Gene SymbolUVSSA
Gene SynonymKIAA1530; UVSS3
Chromosome4
Locus Map4p16.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_020894 Homo sapiens UV-stimulated scaffold protein A (UVSSA), mRNA. Full Length $1632.75
ORF Sequence $617.70
Title KIAA1530 protein is recruited by Cockayne syndrome complementation group protein A (CSA) to participate in transcription-coupled repair (TCR) .
Author Fei,J. and Chen,J.
Journal J. Biol. Chem. 287 (42), 35118-35126 (2012)
Title Mutations in UVSSA cause UV-sensitive syndrome and destabilize ERCC6 in transcription-coupled DNA repair .
Author Zhang,X., Horibata,K., Saijo,M., Ishigami,C., Ukai,A., Kanno,S., Tahara,H., Neilan,E.G., Honma,M., Nohmi,T., Yasui,A. and Tanaka,K.
Journal Nat. Genet. 44 (5), 593-597 (2012)
Title UV-sensitive syndrome protein UVSSA recruits USP7 to regulate transcription-coupled repair .
Author Schwertman,P., Lagarou,A., Dekkers,D.H., Raams,A., van der Hoek,A.C., Laffeber,C., Hoeijmakers,J.H., Demmers,J.A., Fousteri,M., Vermeulen,W. and Marteijn,J.A.
Journal Nat. Genet. 44 (5), 598-602 (2012)
Title Mutations in UVSSA cause UV-sensitive syndrome and impair RNA polymerase IIo processing in transcription-coupled nucleotide-excision repair .
Author Nakazawa,Y., Sasaki,K., Mitsutake,N., Matsuse,M., Shimada,M., Nardo,T., Takahashi,Y., Ohyama,K., Ito,K., Mishima,H., Nomura,M., Kinoshita,A., Ono,S., Takenaka,K., Masuyama,R., Kudo,T., Slor,H., Utani,A., Tateishi,S., Yamashita,S., Stefanini,M., Lehmann,A.R., Yoshiura,K. and Ogi,T.
Journal Nat. Genet. 44 (5), 586-592 (2012)
Title Joint influence of small-effect genetic variants on human longevity .
Author Yashin,A.I., Wu,D., Arbeev,K.G. and Ukraintseva,S.V.
Journal Aging (Albany NY) 2 (9), 612-620 (2010)
Title hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes .
Author Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z., Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S., McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J., Dunham,I., Hill,D.E. and Vidal,M.
Journal Genomics 89 (3), 307-315 (2007)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878