• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens UV-stimulated scaffold protein A (UVSSA), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu24338 Homo sapiens UV-stimulated scaffold protein A (UVSSA), mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu24338C Homo sapiens UV-stimulated scaffold protein A (UVSSA), mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_020894.2, 190358542
Length 2130 bp
Structure linear
Update Date 14-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens UV-stimulated scaffold protein A (UVSSA), mRNA.
Product UV-stimulated scaffold protein A
Comment

Summary: The protein encoded by this gene appears to be involved in ubiquitination and dephosphorylation of RNA polymerase II subunits that stall after UV irradiation. The encoded protein interacts with several members of the nucleotide excision repair complex to help repair UV-induced DNA damage. Defects in this gene can cause UV-sensitive syndrome 3. [provided by RefSeq, May 2012].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.


##Evidence-Data-START## Transcript exon combination :: AB040963.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_065945.2
CDS 448..2577
Misc Feature(1)190..192
Misc Feature(2)451..882
Misc Feature(3)451..882
Misc Feature(4)1288..1290
Misc Feature(5)1306..1308
Misc Feature(6)1930..2262
Exon (1)1..445
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (2)446..545
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (3)546..876
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (4)877..997
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (5)998..1381
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (6)1382..1494
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (7)1495..1623
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (8)1624..1735
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (9)1736..1880
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (10)1881..2015
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (11)2016..2199
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (12)2200..2308
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (13)2309..2483
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Exon (14)2484..4665
Gene:UVSSA
Gene Synonym:KIAA1530; UVSS3
Translation MDQKLSKLVEELTTSGEPRLNPEKMKELKKICKSSEEQLSRAYRLLIAQLTQEHAEIRLS AFQIVEELFVRSHQFRMLVVSNFQEFLELTLGTDPAQPLPPPREAAQRLRQATTRAVEGW NEKFGEAYKKLALGYHFLRHNKKVDFQDTNARSLAERKREEEKQKHLDKIYQERASQAER EMQEMSGEIESCLTEVESCFRLLVPFDFDPNPETESLGMASGMSDALRSSCAGQVGPCRS GTPDPRDGEQPCCSRDLPASAGHPRAGGGAQPSQTATGDPSDEDEDSDLEEFVRSHGLGS HKYTLDVELCSEGLKVQENEDNLALIHAARDTLKLIRNKFLPAVCSWIQRFTRVGTHGGC LKRAIDLKAELELVLRKYKELDIEPEGGERRRTEALGDAEEDEDDEDFVEVPEKEGYEPH IPDHLRPEYGLEAAPEKDTVVRCLRTRTRMDEEVSDPTSAAAQLRQLRDHLPPPSSASPS RALPEPQEAQKLAAERARAPVVPYGVDLHYWGQELPTAGKIVKSDSQHRFWKPSEVEEEV VNADISEMLRSRHITFAGKFEPVQHWCRAPRPDGRLCERQDRLKCPFHGKIVPRDDEGRP LDPEDRAREQRRQLQKQERPEWQDPELMRDVEAATGQDLGSSRYSGKGRGKKRRYPSLTN LKAQADTARARIGRKVFAKAAVRRVVAAMNRMDQKKHEKFSNQFNYALN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
163+dbSNP:
163+c, tdbSNP:139033323
188+a, gdbSNP:71614967
196+a, gdbSNP:13146729
307+g, tdbSNP:116170374
335+c, tdbSNP:375848251
464+c, tdbSNP:138607842
473+c, tdbSNP:368110594
475+a, gdbSNP:149266206
502+c, tdbSNP:199574083
503+a, gdbSNP:116804738
541+c, tdbSNP:387907164
542+g, tdbSNP:371932049
548+dbSNP:
548+c, tdbSNP:144988532
558+g, tdbSNP:139792832
570+c, tdbSNP:62000970
575+a, gdbSNP:201659434
604+c, gdbSNP:140162022
610+a, gdbSNP:200842541
612+c, gdbSNP:373466926
618+c, tdbSNP:143918768
622+c, tdbSNP:374846806
624+c, gdbSNP:368263043
639+c, tdbSNP:2276903
649+c, gdbSNP:370699245
652+g, tdbSNP:200608307
655+g, tdbSNP:151085866
659+a, gdbSNP:200262507
679+c, gdbSNP:372340848
705+c, gdbSNP:182881806
724+a, gdbSNP:199918903
725+c, gdbSNP:374656092
746+c, tdbSNP:201608727
752+c, gdbSNP:372384911
761+c, tdbSNP:200196963
762+a, gdbSNP:149796000
764+a, cdbSNP:374486122
781+a, gdbSNP:145739457
785+a, cdbSNP:140611637
790+c, tdbSNP:145622542
793+c, gdbSNP:376077428
796+a, gdbSNP:201486316
800+a, tdbSNP:200231004
814+a, tdbSNP:387907163
831+c, tdbSNP:369196034
836+a, gdbSNP:112417076
843+c, gdbSNP:377071239
855+c, tdbSNP:372688958
858+c, gdbSNP:377140234
891+dbSNP:
891+a, cdbSNP:138228745
901+c, tdbSNP:141095512
911+c, tdbSNP:201414673
913+c, gdbSNP:368797236
931+a, gdbSNP:200745723
943+a, cdbSNP:200811036
951+a, tdbSNP:200163688
971+c, tdbSNP:143198789
980+a, cdbSNP:373828028
981+a, gdbSNP:201407968
1000+dbSNP:
1000+a, gdbSNP:376480468
1019+a, c, tdbSNP:200478324
1024+c, tdbSNP:148246275
1026+g, tdbSNP:374789666
1028+c, tdbSNP:141286641
1055+a, tdbSNP:367736394
1060+a, cdbSNP:150774883
1072+g, tdbSNP:137963993
1076+c, tdbSNP:143547791
1077+a, gdbSNP:147131553
1083+a, gdbSNP:77892061
1088+c, tdbSNP:150060662
1089+a, gdbSNP:144411768
1125+a, cdbSNP:371958204
1129+c, tdbSNP:148799777
1140+c, tdbSNP:115978884
1143+a, gdbSNP:146853550
1154+c, gdbSNP:201508186
1162+c, tdbSNP:375280783
1163+a, gdbSNP:140577099
1183+c, tdbSNP:144329202
1184+a, gdbSNP:76217876
1226+c, tdbSNP:371967224
1232+g, tdbSNP:376606770
1248+c, tdbSNP:182834064
1270+a, gdbSNP:200874287
1308+c, tdbSNP:146539928
1309+a, gdbSNP:141268114
1310+a, tdbSNP:369834389
1314+c, tdbSNP:200424814
1315+a, gdbSNP:199781120
1324+a, gdbSNP:150164998
1327+c, tdbSNP:145597820
1347+a, gdbSNP:374676414
1359+a, gdbSNP:369014709
1398+dbSNP:
1398+g, tdbSNP:12644923
1404+c, tdbSNP:373061652
1429+a, gdbSNP:143536293
1431+c, tdbSNP:138129709
1432+g, tdbSNP:188017443
1435+c, tdbSNP:143509490
1436+a, gdbSNP:201333426
1437+c, tdbSNP:145897251
1440+c, tdbSNP:149078829
1441+a, gdbSNP:138649386
1452+c, tdbSNP:141128227
1456+c, tdbSNP:113866137
1461+c, tdbSNP:184622678
1473+a, gdbSNP:139957083
1479+a, gdbSNP:372630188
1481+g, tdbSNP:149434443
1507+dbSNP:
1507+a, g, tdbSNP:138618709
1510+a, gdbSNP:116741007
1526+g, tdbSNP:367978617
1529+g, tdbSNP:201115491
1534+c, tdbSNP:139719436
1536+c, tdbSNP:144288420
1537+a, gdbSNP:372683434
1567+a, gdbSNP:375462314
1577+a, gdbSNP:200309770
1596+c, tdbSNP:146589878
1619+a, gdbSNP:2276904
1642+dbSNP:
1642+a, gdbSNP:372879243
1644+a, gdbSNP:374042356
1656+a, gdbSNP:200469736
1660+a, gdbSNP:142249516
1677+c, gdbSNP:370740292
1710+c, gdbSNP:184668136
1713+c, tdbSNP:151254049
1714+c, gdbSNP:140365902
1723+c, tdbSNP:201394250
1762+dbSNP:
1762+a, cdbSNP:147019484
1776+c, tdbSNP:367794912
1780+c, tdbSNP:147609449
1781+a, gdbSNP:370438884
1790+c, tdbSNP:201913293
1795+a, gdbSNP:371991080
1800+c, tdbSNP:377154812
1808+g, tdbSNP:142208115
1811+c, tdbSNP:202127588
1820+c, tdbSNP:375219415
1821+c, gdbSNP:369537231
1826+c, tdbSNP:372374507
1834+c, tdbSNP:138697244
1841+a, gdbSNP:200830830
1844..1845+, gdbSNP:138106588
1849+c, tdbSNP:201031469
1850+a, gdbSNP:149276991
1863+g, tdbSNP:377144806
1865+, cdbSNP:35031262
1869+c, tdbSNP:71606322
1871+c, tdbSNP:369781602
1892+dbSNP:
1892+c, tdbSNP:372761159
1893+a, gdbSNP:114098503
1929+a, gdbSNP:147989651
1933+c, tdbSNP:375916612
1939+c, tdbSNP:141563406
1940+a, gdbSNP:146406848
1944+a, gdbSNP:11724369
1945+c, tdbSNP:370594909
1951+a, gdbSNP:192415191
1954+c, tdbSNP:376244550
1968+c, tdbSNP:370966636
1973+a, cdbSNP:368442048
1992+c, tdbSNP:142916158
2001+c, tdbSNP:146124669
2017+dbSNP:
2017+c, tdbSNP:111846369
2018+c, tdbSNP:200573569
2033+a, gdbSNP:374567722
2055+a, gdbSNP:368934680
2076+c, gdbSNP:199552593
2077+a, gdbSNP:200658998
2085+c, tdbSNP:369122129
2086+g, tdbSNP:190971132
2095+c, tdbSNP:139749595
2096+a, gdbSNP:374515733
2102+a, gdbSNP:368030696
2109+c, tdbSNP:149802815
2118+c, tdbSNP:200505151
2139+a, gdbSNP:369644768
2150+a, gdbSNP:373957476
2158+a, gdbSNP:145701437
2159+a, gdbSNP:369990759
2167+a, gdbSNP:182731155
2175+c, tdbSNP:377637760
2181+a, gdbSNP:148515747
2182+c, tdbSNP:370230075
2185+a, cdbSNP:144530948
2227+dbSNP:
2227+a, cdbSNP:28614045
2240+a, gdbSNP:142276654
2246+c, tdbSNP:77731309
2255+c, tdbSNP:193009688
2257+c, gdbSNP:199921553
2269+c, tdbSNP:201799212
2276+a, gdbSNP:151199613
2278+c, tdbSNP:140176848
2282+a, gdbSNP:376949347
2301+a, gdbSNP:115722661
2306+c, tdbSNP:28522910
2314+dbSNP:
2314+c, tdbSNP:372308335
2323+c, gdbSNP:376594165
2338+c, gdbSNP:140839981
2370+a, gdbSNP:9996817
2380+a, gdbSNP:201318732
2382+c, tdbSNP:138454833
2396+g, tdbSNP:200802210
2403+a, gdbSNP:146112543
2417+g, tdbSNP:372810026
2434+a, gdbSNP:148359793
2454+c, tdbSNP:141457671
2455+a, gdbSNP:150863986
2458+c, tdbSNP:372587885
2462+c, tdbSNP:368990503
2478+c, tdbSNP:199557939
2479+a, gdbSNP:139310992
2500+dbSNP:
2500+c, gdbSNP:187456912
2509+a, gdbSNP:145324347
2511+c, tdbSNP:369372040
2519+a, gdbSNP:147251189
2539+a, gdbSNP:140574139
2559+c, tdbSNP:373112434
2565+c, tdbSNP:144550138
2568+a, c, gdbSNP:145552493
2579+a, gdbSNP:148888724
2591+a, gdbSNP:369821285
2608+a, gdbSNP:373234594
2629+c, gdbSNP:149418525
2796+c, tdbSNP:183282542
2847+c, tdbSNP:372474367
2856+a, gdbSNP:144791465
2861+a, gdbSNP:6838561
2880+c, tdbSNP:114225009
2893+a, gdbSNP:116475969
2897+c, gdbSNP:377104789
2937+c, tdbSNP:116685682
2986+c, tdbSNP:78986148
3029+c, gdbSNP:75400033
3085+, cdbSNP:150381588
3098+c, tdbSNP:369440123
3168+c, gdbSNP:62284756
3183+a, tdbSNP:372979502
3233+c, tdbSNP:142884195
3266+a, gdbSNP:78117292
3297+g, tdbSNP:377186052
3333..3334+, t, ttdbSNP:35810542
3333+g, tdbSNP:200546473
3341..3342+, t, ttdbSNP:56335346
3342+g, tdbSNP:13122610
3527+a, gdbSNP:4974558
3612+a, gdbSNP:375252932
3676+a, gdbSNP:4974559
3688..3689+, tttadbSNP:371108877
3734+a, gdbSNP:140801789
3796+c, tdbSNP:111610721
3801+c, tdbSNP:376272325
3829..3830+, tdbSNP:34554552
3839+a, gdbSNP:147863813
3841+a, gdbSNP:192085591
3844+c, tdbSNP:184680283
3850+c, tdbSNP:188243543
3892+c, tdbSNP:192528919
3894+a, gdbSNP:13123788
3909+a, gdbSNP:111792007
3941+c, tdbSNP:13125500
3943+c, tdbSNP:370236127
3951..3952+, cdbSNP:375564118
3981+c, tdbSNP:184955128
4037+a, gdbSNP:12640103
4093+c, tdbSNP:10678
4101+g, tdbSNP:189067218
4110+c, tdbSNP:367828941
4172+a, gdbSNP:61694619
4243+g, tdbSNP:9603
4295+c, tdbSNP:145575243
4333+a, gdbSNP:180958717
4339+a, gdbSNP:148884141
4401+a, gdbSNP:143542918
4409+c, gdbSNP:184657776
4485+g, tdbSNP:371834466
4501+g, tdbSNP:200556028
4548+c, tdbSNP:137960699
4560+a, cdbSNP:75915160
4561+a, cdbSNP:367886266
4624+a, gdbSNP:368247139
4626+a, gdbSNP:1137789
4652+a, cdbSNP:142451255
Gene SymbolUVSSA
Gene SynonymKIAA1530; UVSS3
Chromosome4
Locus Map4p16.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_020894 Homo sapiens UV-stimulated scaffold protein A (UVSSA), mRNA. On-demand $279.00 12-14
NM_020894 Homo sapiens UV-stimulated scaffold protein A (UVSSA), mRNA. On-demand $279.00 12-14
NM_020894 Homo sapiens UV-stimulated scaffold protein A (UVSSA), mRNA. On-demand $279.00 12-14
NM_020894 Homo sapiens UV-stimulated scaffold protein A (UVSSA), mRNA. On-demand $279.00 12-14
NM_020894 Homo sapiens UV-stimulated scaffold protein A (UVSSA), mRNA. On-demand $279.00 12-14
Title UVSSA and USP7, a new couple in transcription-coupled DNA repair .
Author Schwertman P, Vermeulen W and Marteijn JA.
Journal Chromosoma 122 (4), 275-284 (2013)
Title [Molecular cloning and characterisation of UVSSA, the responsible gene for UV-sensitive syndrome] .
Author Ogi T, Nakazawa Y, Sasaki K, Guo C, Yoshiura K, Utani A and Nagayama Y.
Journal Seikagaku 85 (3), 133-144 (2013)
Title KIAA1530 protein is recruited by Cockayne syndrome complementation group protein A (CSA) to participate in transcription-coupled repair (TCR) .
Author Fei J and Chen J.
Journal J. Biol. Chem. 287 (42), 35118-35126 (2012)
Title Mutations in UVSSA cause UV-sensitive syndrome and destabilize ERCC6 in transcription-coupled DNA repair .
Author Zhang X, Horibata K, Saijo M, Ishigami C, Ukai A, Kanno S, Tahara H, Neilan EG, Honma M, Nohmi T, Yasui A and Tanaka K.
Journal Nat. Genet. 44 (5), 593-597 (2012)
Title UV-sensitive syndrome protein UVSSA recruits USP7 to regulate transcription-coupled repair .
Author Schwertman P, Lagarou A, Dekkers DH, Raams A, van der Hoek AC, Laffeber C, Hoeijmakers JH, Demmers JA, Fousteri M, Vermeulen W and Marteijn JA.
Journal Nat. Genet. 44 (5), 598-602 (2012)
Title Mutations in UVSSA cause UV-sensitive syndrome and impair RNA polymerase IIo processing in transcription-coupled nucleotide-excision repair .
Author Nakazawa Y, Sasaki K, Mitsutake N, Matsuse M, Shimada M, Nardo T, Takahashi Y, Ohyama K, Ito K, Mishima H, Nomura M, Kinoshita A, Ono S, Takenaka K, Masuyama R, Kudo T, Slor H, Utani A, Tateishi S, Yamashita S, Stefanini M, Lehmann AR, Yoshiura K and Ogi T.
Journal Nat. Genet. 44 (5), 586-592 (2012)
Title Joint influence of small-effect genetic variants on human longevity .
Author Yashin AI, Wu D, Arbeev KG and Ukraintseva SV.
Journal Aging (Albany NY) 2 (9), 612-620 (2010)
Title hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes .
Author Lamesch P, Li N, Milstein S, Fan C, Hao T, Szabo G, Hu Z, Venkatesan K, Bethel G, Martin P, Rogers J, Lawlor S, McLaren S, Dricot A, Borick H, Cusick ME, Vandenhaute J, Dunham I, Hill DE and Vidal M.
Journal Genomics 89 (3), 307-315 (2007)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.