• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens adenylate cyclase 6 (ADCY6), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_020983 Homo sapiens adenylate cyclase 6 (ADCY6), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_020983.2, 21071019
Length 5877 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens adenylate cyclase 6 (ADCY6), transcript variant 2, mRNA.
Product adenylate cyclase type 6 isoform b
Comment

Summary: This gene encodes adenylate cyclase 6, which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). The expression of this gene is found in normal thyroid and brain tissues, as well as some tumors; and its expression is significantly higher in one hyperfunctioning thyroid tumor than in normal thyroid tissue. Alternative splicing generates 2 transcript variants. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) has a different and shorter 5' UTR and lacks an in-frame fragment of 159 bp in the coding region, as compared to variant 1. Isoform b encoded by this variant has the same N- and C- termini as isoform a encoded by variant 1, but lacks internal 53 aa.

RefSeq NP_066193.1
CDS 137..3484
Misc Feature(1)296..298
Misc Feature(2)296..298
Misc Feature(3)1136..1723
Misc Feature(4)1265..1792
Misc Feature(5)order(1280..1282,1286..1303,1406..1408,1412..1420,
Misc Feature(6)order(1286..1288,1418..1420)
Misc Feature(7)order(1301..1303,1337..1339,1346..1351,1358..1360,
Misc Feature(8)1868..2143
Misc Feature(9)2807..3412
Misc Feature(10)2909..3463
Misc Feature(11)order(2921..2923,2927..2944,3068..3070,3074..3082,
Misc Feature(12)order(2927..2929,3080..3082)
Misc Feature(13)order(2942..2944,2990..2992,2999..3004,3011..3013,
Exon (1)1..132
Gene:ADCY6
Gene Synonym:AC6
Exon (2)133..1000
Gene:ADCY6
Gene Synonym:AC6
Exon (3)1001..1150
Gene:ADCY6
Gene Synonym:AC6
Exon (4)1151..1272
Gene:ADCY6
Gene Synonym:AC6
Exon (5)1273..1384
Gene:ADCY6
Gene Synonym:AC6
Exon (6)1385..1512
Gene:ADCY6
Gene Synonym:AC6
Exon (7)1513..1671
Gene:ADCY6
Gene Synonym:AC6
Exon (8)1672..1813
Gene:ADCY6
Gene Synonym:AC6
Exon (9)1814..1942
Gene:ADCY6
Gene Synonym:AC6
Exon (10)1943..1968
Gene:ADCY6
Gene Synonym:AC6
Exon (11)1969..2116
Gene:ADCY6
Gene Synonym:AC6
Exon (12)2117..2214
Gene:ADCY6
Gene Synonym:AC6
Exon (13)2215..2302
Gene:ADCY6
Gene Synonym:AC6
Exon (14)2303..2419
Gene:ADCY6
Gene Synonym:AC6
Exon (15)2420..2598
Gene:ADCY6
Gene Synonym:AC6
Exon (16)2599..2634
Gene:ADCY6
Gene Synonym:AC6
Exon (17)2635..2764
Gene:ADCY6
Gene Synonym:AC6
Exon (18)2765..3028
Gene:ADCY6
Gene Synonym:AC6
Exon (19)3029..3233
Gene:ADCY6
Gene Synonym:AC6
Exon (20)3234..3358
Gene:ADCY6
Gene Synonym:AC6
Exon (21)3359..5877
Gene:ADCY6
Gene Synonym:AC6
Translation MSWFSGLLVPKVDERKTAWGERNGQKRSRRRGTRAGGFCTPRYMSCLRDAEPPSPTPAGP PRCPWQDDAFIRRGGPGKGKELGLRAVALGFEDTEVTTTAGGTAEVAPDAVPRSGRSCWR RLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAY VALLACAAALFVGLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSPSAGLW CPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQLGANVLLFLCTN VIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINT KKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHC LRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRV HCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNA YLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFR QMGIDDSSKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLLTFQREDLEKK YSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGIYASIFLLLLITVLICAVYSC GSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMYFIGNMLLSLLASSVFLHI SSIGKLAMIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVA LKYMTPVILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILP KDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIA DFDEIISEERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHI NEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLY QVLAAKGYQLECRGVVKVKGKGEMTTYFLNGGPSS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(189)-g, adbSNP:200826359
complement(222)-t, cdbSNP:139388558
complement(237)-t, cdbSNP:141574837
complement(241)-t, gdbSNP:2453486
complement(243)-t, cdbSNP:139469334
complement(340)-g, adbSNP:147362088
complement(359)-g, adbSNP:3730307
complement(409)-g, adbSNP:201423806
complement(418)-g, adbSNP:142741824
complement(421)-t, cdbSNP:114125023
complement(457)-c, adbSNP:148650932
complement(482)-c, adbSNP:3730308
complement(490)-g, adbSNP:149512917
complement(494)-g, adbSNP:55770045
complement(534)-g, c, adbSNP:150803944
complement(546)-t, cdbSNP:114021318
complement(549)-t, cdbSNP:115315671
complement(658)-t, gdbSNP:138801065
complement(661)-g, adbSNP:145026035
complement(697)-g, adbSNP:141293016
complement(722)-t, cdbSNP:188795684
complement(725)-t, cdbSNP:199991498
complement(772)-t, cdbSNP:3730064
complement(775)-g, adbSNP:200775328
complement(828)-t, gdbSNP:143737532
complement(846)-g, adbSNP:148986045
complement(847)-t, cdbSNP:145846390
complement(851)-g, cdbSNP:200593680
complement(889)-t, cdbSNP:185259602
complement(911)-t, cdbSNP:144914540
complement(1004)-dbSNP:
complement(1004)-t, cdbSNP:150687056
complement(1011)-t, cdbSNP:201826042
complement(1053)-g, adbSNP:142659911
complement(1170)-dbSNP:
complement(1170)-c, adbSNP:74468932
complement(1183)-g, adbSNP:147771277
complement(1289)-dbSNP:
complement(1289)-t, adbSNP:144246626
complement(1327)-t, cdbSNP:139495277
complement(1357)-g, adbSNP:55872249
complement(1363)-g, adbSNP:150537242
complement(1397)-dbSNP:
complement(1397)-g, adbSNP:71464932
complement(1405)-g, cdbSNP:142601797
complement(1411)-t, gdbSNP:148459653
complement(1447)-c, adbSNP:147469347
complement(1469)-t, gdbSNP:201102889
complement(1529)-dbSNP:
complement(1529)-t, cdbSNP:141847908
complement(1537)-t, cdbSNP:138780134
complement(1546)-t, cdbSNP:3730067
complement(1573)-t, cdbSNP:3730068
complement(1582)-g, adbSNP:138193379
complement(1646)-g, adbSNP:150432765
complement(1688)-dbSNP:
complement(1688)-g, adbSNP:201227124
complement(1711)-g, adbSNP:116207511
complement(1724)-c, adbSNP:140515100
complement(1742)-t, cdbSNP:148346071
complement(1749)-t, cdbSNP:146870636
complement(1776)-g, adbSNP:143114060
complement(1801)-t, gdbSNP:116290355
complement(1828)-dbSNP:
complement(1828)-g, adbSNP:144153450
complement(1847)-g, adbSNP:56168017
complement(1848)-t, cdbSNP:144929709
complement(1881)-g, adbSNP:114120444
complement(1882)-t, cdbSNP:139118462
complement(1883)-g, adbSNP:146240310
complement(1898)-g, adbSNP:143383917
complement(1976)-dbSNP:
complement(1976)-t, cdbSNP:200812555
complement(1999)-t, cdbSNP:139946348
complement(2008)-t, cdbSNP:146036298
complement(2032)-g, adbSNP:116169976
complement(2040)-t, cdbSNP:148503142
complement(2068)-g, adbSNP:116626928
complement(2071)-t, cdbSNP:144695278
complement(2075)-g, adbSNP:186650360
complement(2076)-t, cdbSNP:200747404
complement(2094)-t, cdbSNP:149376950
complement(2123)-dbSNP:
complement(2123)-g, adbSNP:116786357
complement(2135)-t, gdbSNP:200084328
complement(2144)-t, cdbSNP:55726827
complement(2156)-t, gdbSNP:3730071
complement(2165)-t, gdbSNP:77913913
complement(2212)-t, cdbSNP:147118305
complement(2215)-dbSNP:
complement(2215)-g, adbSNP:140637221
complement(2269)-g, cdbSNP:200574206
complement(2270)-t, cdbSNP:150930409
complement(2275)-g, cdbSNP:143466683
complement(2324)-dbSNP:
complement(2324)-g, adbSNP:199749505
complement(2346)-t, cdbSNP:183886636
complement(2351)-g, adbSNP:201529747
complement(2383)-g, adbSNP:115957272
complement(2423)-dbSNP:
complement(2423)-g, adbSNP:143344638
complement(2485)-g, adbSNP:115965469
complement(2486)-t, cdbSNP:116834962
complement(2548)-g, cdbSNP:146495193
complement(2588)-t, cdbSNP:55797309
complement(2610)-dbSNP:
complement(2610)-t, cdbSNP:139226708
complement(2621)-c, adbSNP:150822886
complement(2622)-t, adbSNP:141421248
complement(2645)-dbSNP:
complement(2645)-t, cdbSNP:140769009
complement(2652)-, adbSNP:34090269
complement(2715)-g, adbSNP:200878567
complement(2738)-g, adbSNP:115351639
complement(2739)-t, cdbSNP:200061969
complement(2770)-dbSNP:
complement(2770)-t, cdbSNP:200640184
complement(2773)-t, cdbSNP:147278695
complement(2871)-t, cdbSNP:143958339
complement(2873)-g, adbSNP:138465901
complement(2898)-g, adbSNP:200070441
complement(2932)-g, adbSNP:143779554
complement(2983)-g, cdbSNP:143018810
complement(3038)-dbSNP:
complement(3038)-g, cdbSNP:138949513
complement(3041)-t, cdbSNP:150284492
complement(3051)-t, cdbSNP:140245629
complement(3134)-g, adbSNP:146684669
complement(3189)-t, cdbSNP:144655757
complement(3215)-t, adbSNP:140931660
complement(3234)-dbSNP:
complement(3234)-c, adbSNP:141820013
complement(3262)-c, adbSNP:200552442
complement(3268)-g, adbSNP:73296123
complement(3276)-t, cdbSNP:142639338
complement(3351)-t, cdbSNP:148471651
complement(3419)-dbSNP:
complement(3419)-g, cdbSNP:200204618
complement(3422)-t, cdbSNP:145630064
complement(3465)-t, cdbSNP:149764790
complement(3570)-t, cdbSNP:207472920
complement(3605)-g, cdbSNP:3729973
complement(3661)-t, gdbSNP:147963105
complement(3685)-t, gdbSNP:185638739
complement(3776)-g, cdbSNP:144955011
complement(4337)-g, adbSNP:56009129
complement(4338)-t, cdbSNP:148713267
complement(4341)-t, cdbSNP:74512157
complement(4462)-t, gdbSNP:7961282
complement(4579..4580)-, tdbSNP:34681523
complement(4770)-t, cdbSNP:150009601
complement(4808)-c, adbSNP:56258492
complement(4843)-c, adbSNP:139309787
complement(4892)-t, cdbSNP:55708807
complement(4921)-g, adbSNP:60640368
complement(4965)-t, cdbSNP:1044574
complement(5069)-, gdbSNP:141933511
complement(5264)-g, adbSNP:146231750
complement(5312)-g, cdbSNP:192676519
complement(5346..5347)-, ggcdbSNP:140559205
complement(5417)-t, cdbSNP:187444340
complement(5455)-t, cdbSNP:183152956
complement(5475)-t, cdbSNP:190693682
complement(5763)-g, cdbSNP:71464931
Gene SymbolADCY6
Gene SynonymAC6
Chromosome12
Locus Map12q12-q13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_015270 Homo sapiens adenylate cyclase 6 (ADCY6), transcript variant 1, mRNA. On-demand $1699.00 25
NM_020983 Homo sapiens adenylate cyclase 6 (ADCY6), transcript variant 2, mRNA. On-demand $1699.00 25
Title Human bronchial smooth muscle cells express adenylyl cyclase isoforms 2, 4, and 6 in distinct membrane microdomains .
Author Bogard,A.S., Xu,C. and Ostrom,R.S.
Journal J. Pharmacol. Exp. Ther. 337 (1), 209-217 (2011)
Title PPARgamma-dependent regulation of adenylate cyclase 6 amplifies the stimulatory effect of cAMP on renin gene expression .
Author Desch,M., Schubert,T., Schreiber,A., Mayer,S., Friedrich,B., Artunc,F. and Todorov,V.T.
Journal Mol. Endocrinol. 24 (11), 2139-2151 (2010)
Title Increased blood pressure and hyperdynamic cardiovascular responses in carriers of a common hyperfunctional variant of adenylyl cyclase 6 .
Author Hodges,G.J., Gros,R., Hegele,R.A., Van Uum,S., Shoemaker,J.K. and Feldman,R.D.
Journal J. Pharmacol. Exp. Ther. 335 (2), 451-457 (2010)
Title Real-time monitoring of cAMP levels in living endothelial cells: thrombin transiently inhibits adenylyl cyclase 6 .
Author Werthmann,R.C., von Hayn,K., Nikolaev,V.O., Lohse,M.J. and Bunemann,M.
Journal J. Physiol. (Lond.) 587 (PT 16), 4091-4104 (2009)
Title The C1 and C2 domains target human type 6 adenylyl cyclase to lipid rafts and caveolae .
Author Thangavel,M., Liu,X., Sun,S.Q., Kaminsky,J. and Ostrom,R.S.
Journal Cell. Signal. 21 (2), 301-308 (2009)
Title Purification and characterization of a soluble form of mammalian adenylyl cyclase .
Author Dessauer,C.W. and Gilman,A.G.
Journal J. Biol. Chem. 271 (28), 16967-16974 (1996)
Title Mammalian adenylyl cyclase family members are randomly located on different chromosomes .
Author Gaudin,C., Homcy,C.J. and Ishikawa,Y.
Journal Hum. Genet. 94 (5), 527-529 (1994)
Title Mechanism of GTP hydrolysis by G-protein alpha subunits .
Author Kleuss,C., Raw,A.S., Lee,E., Sprang,S.R. and Gilman,A.G.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (21), 9828-9831 (1994)
Title Chromosomal mapping of human adenylyl cyclase genes type III, type .
Author Haber,N., Stengel,D., Defer,N., Roeckel,N., Mattei,M.G. and Hanoune,J.
Journal Hum. Genet. 94 (1), 69-73 (1994)
Title cAMP-dependent protein kinase: framework for a diverse family of regulatory enzymes .
Author Taylor,S.S., Buechler,J.A. and Yonemoto,W.
Journal Annu. Rev. Biochem. 59, 971-1005 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.