• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens interferon, alpha 6 (IFNA6), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu32296 Homo sapiens interferon, alpha 6 (IFNA6), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu32296C Homo sapiens interferon, alpha 6 (IFNA6), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_021002.2, 291463312
Length 570 bp
Structure linear
Update Date 03-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens interferon, alpha 6 (IFNA6), mRNA.
Product interferon alpha-6 precursor
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL353732.14. On Mar 24, 2010 this sequence version replaced gi:11128014.


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_066282.1
CDS 1..570
Misc Feature(1)76..534
Misc Feature(2)order(82..87,94..96,103..108,115..117,124..129,298..303,
Misc Feature(3)order(157..180,184..192,208..213,421..426,430..435,
Misc Feature(4)301..303
Translation MALPFALLMALVVLSCKSSCSLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFR FPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLE ACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRN LQERLRRKE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(1)-t, cdbSNP:199909475
complement(65)-g, adbSNP:150008995
complement(84)-t, cdbSNP:114283047
complement(139)-t, cdbSNP:190705153
complement(146)-g, adbSNP:61736254
complement(150)-g, adbSNP:144160887
complement(152)-g, cdbSNP:375617147
complement(156)-g, adbSNP:61736255
complement(170)-t, cdbSNP:372927228
complement(177)-g, adbSNP:200999463
complement(178)-t, cdbSNP:201824804
complement(186)-g, adbSNP:61736257
complement(187)-g, adbSNP:370196139
complement(247)-c, adbSNP:141284622
complement(253)-g, adbSNP:112773436
complement(260)-t, gdbSNP:189717919
complement(262)-g, adbSNP:369385528
complement(267)-g, adbSNP:2988573
complement(283)-t, cdbSNP:186416653
complement(284)-t, cdbSNP:76096785
complement(285)-g, adbSNP:375649668
complement(292)-t, cdbSNP:147415542
complement(310)-g, adbSNP:142796435
complement(385)-t, cdbSNP:137921767
complement(389)-g, cdbSNP:372401225
complement(399)-g, cdbSNP:370092473
complement(400)-g, adbSNP:61736258
complement(411)-t, cdbSNP:141102746
complement(464)-t, gdbSNP:202179791
complement(497)-c, adbSNP:138969995
complement(509)-t, gdbSNP:150269404
complement(521)-g, cdbSNP:200866459
complement(544)-t, gdbSNP:370874088
complement(567)-t, cdbSNP:141069504
Gene SymbolIFNA6
Gene SynonymIFN-alphaK
Chromosome9
Locus Map9p22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_021002 Homo sapiens interferon, alpha 6 (IFNA6), mRNA. In-stock $99.00 5-7
Title Associations of 9p21 variants with cutaneous malignant melanoma, nevi, and pigmentation phenotypes in melanoma-prone families with and without CDKN2A mutations .
Author Yang XR, Liang X, Pfeiffer RM, Wheeler W, Maeder D, Burdette L, Yeager M, Chanock S, Tucker MA and Goldstein AM.
Journal Fam. Cancer 9 (4), 625-633 (2010)
Title Dengue hemorrhagic fever is associated with polymorphisms in JAK1 .
Author Silva LK, Blanton RE, Parrado AR, Melo PS, Morato VG, Reis EA, Dias JP, Castro JM, Vasconcelos PF, Goddard KA, Barreto ML, Reis MG and Teixeira MG.
Journal Eur. J. Hum. Genet. 18 (11), 1221-1227 (2010)
Title Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls .
Author Schuurhof A, Bont L, Siezen CL, Hodemaekers H, van Houwelingen HC, Kimman TG, Hoebee B, Kimpen JL and Janssen R.
Journal Pediatr. Pulmonol. 45 (6), 608-613 (2010)
Title Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus .
Author Mosbruger TL, Duggal P, Goedert JJ, Kirk GD, Hoots WK, Tobler LH, Busch M, Peters MG, Rosen HR, Thomas DL and Thio CL.
Journal J. Infect. Dis. 201 (9), 1371-1380 (2010)
Title New genetic associations detected in a host response study to hepatitis B vaccine .
Author Davila S, Froeling FE, Tan A, Bonnard C, Boland GJ, Snippe H, Hibberd ML and Seielstad M.
Journal Genes Immun. 11 (3), 232-238 (2010)
Title Identification of nine interferon-alpha subtypes produced by Sendai virus-induced human peripheral blood leucocytes .
Author Nyman TA, Tolo H, Parkkinen J and Kalkkinen N.
Journal Biochem. J. 329 (PT 2), 295-302 (1998)
Title Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest .
Author Tiefenbrun N, Melamed D, Levy N, Resnitzky D, Hoffman I, Reed SI and Kimchi A.
Journal Mol. Cell. Biol. 16 (7), 3934-3944 (1996)
Title Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions .
Author Shuai K, Horvath CM, Huang LH, Qureshi SA, Cowburn D and Darnell JE Jr.
Journal Cell 76 (5), 821-828 (1994)
Title Mapping of the shortest region of overlap of deletions of the short arm of chromosome 9 associated with human neoplasia .
Author Olopade OI, Bohlander SK, Pomykala H, Maltepe E, Van Melle E, Le Beau MM and Diaz MO.
Journal Genomics 14 (2), 437-443 (1992)
Title Structural relationship of human interferon alpha genes and pseudogenes .
Author Henco,K., Brosius,J., Fujisawa,A., Fujisawa,J.I., Haynes,J.R., Hochstadt,J., Kovacic,T., Pasek,M., Schambock,A., Schmid,J. et al.
Journal J. Mol. Biol. 185 (2), 227-260 (1985)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.