• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens breakpoint cluster region (BCR), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_021574 Homo sapiens breakpoint cluster region (BCR), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_021574.2, 82546844
Length 6795 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens breakpoint cluster region (BCR), transcript variant 2, mRNA.
Product breakpoint cluster region protein isoform 2
Comment

Summary: A reciprocal translocation between chromosomes 22 and 9 produces the Philadelphia chromosome, which is often found in patients with chronic myelogenous leukemia. The chromosome 22 breakpoint for this translocation is located within the BCR gene. The translocation produces a fusion protein which is encoded by sequence from both BCR and ABL, the gene at the chromosome 9 breakpoint. Although the BCR-ABL fusion protein has been extensively studied, the function of the normal BCR gene product is not clear. The protein has serine/threonine kinase activity and is a GTPase-activating protein for p21rac. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) lacks an alternate in-frame exon compared to variant 1. The resulting isoform (2) has the same N- and C-termini but is shorter compared to isoform 1.

RefSeq NP_067585.2
CDS 597..4280
Misc Feature(1)546..548
Misc Feature(2)600..812
Misc Feature(3)600..812
Misc Feature(4)<882..1100
Misc Feature(5)1125..1127
Misc Feature(6)1125..1127
Misc Feature(7)1332..1334
Misc Feature(8)1422..1424
Misc Feature(9)1431..1433
Misc Feature(10)1443..1445
Misc Feature(11)1524..1526
Misc Feature(12)1578..1580
Misc Feature(13)1656..1658
Misc Feature(14)1674..1676
Misc Feature(15)1971..1973
Misc Feature(16)1983..1985
Misc Feature(17)1995..1997
Misc Feature(18)2091..2663
Misc Feature(19)order(2109..2111,2121..2123,2412..2414,2514..2519,
Misc Feature(20)2367..2369
Misc Feature(21)2526..2528
Misc Feature(22)2676..3197
Misc Feature(23)3333..3563
Misc Feature(24)3618..4220
Misc Feature(25)order(3732..3734,3849..3851,3861..3863,4068..4070,
Misc Feature(26)3732..3734
Exon (1)1..1875
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (2)1876..2057
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (3)2058..2162
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (4)2163..2348
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (5)2349..2456
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (6)2457..2517
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (7)2518..2570
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (8)2571..2711
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (9)2712..2833
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (10)2834..3002
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (11)3003..3122
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (12)3123..3198
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (13)3199..3303
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (14)3304..3378
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (15)3379..3476
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (16)3477..3536
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (17)3537..3646
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (18)3647..3786
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (19)3787..3921
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (20)3922..4027
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (21)4028..4190
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Exon (22)4191..6795
Gene:BCR
Gene Synonym:ALL; BCR1; CML; D22S11; D22S662; PHL
Translation MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ TLLAKEKKSYDRQRWGFRRAAQAPDGASEPRASASRPQPAPADGADPPPAEEPEARPDGE GSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSC GVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQSIYVGGMMEGEGKGPLLRSQ STSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEG AFHGDADGSFGTPPGYGCAADRAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSRDALVSG ALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS QQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGV AMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDL LKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVE GARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDELEAVPNIPLVP DEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRN GKSYTFLISSDYERAEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTIN KEDDESPGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNE LDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRER SKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAI AGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLD HLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQ VLLYFLQLEAIPAPDSKRQSILFSTEV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
1+dbSNP:
1+, gdbSNP:369718898
118+g, tdbSNP:112947658
228..229+, gdbSNP:373742833
238..240+(cgg)6, 10, 12, 9dbSNP:3138696
253+c, gdbSNP:112064774
259+a, gdbSNP:75147926
339+g, tdbSNP:180778730
401+c, tdbSNP:75695389
488..489+, gdbSNP:201435938
522..523+, cdbSNP:370385572
531..532+, cdbSNP:199698427
563+a, gdbSNP:370530698
588+a, gdbSNP:139121414
596+a, cdbSNP:368527107
634+a, cdbSNP:199561166
635+g, tdbSNP:375737541
644+c, gdbSNP:372973719
661+g, tdbSNP:376532812
682+a, gdbSNP:367800501
692+g, tdbSNP:144606065
713+a, gdbSNP:371981643
734+g, tdbSNP:138513724
745+a, gdbSNP:376768223
758+c, tdbSNP:112539379
787+c, gdbSNP:201420748
791+a, gdbSNP:200682633
811+c, gdbSNP:369488601
991+c, gdbSNP:200084105
1051+c, tdbSNP:149933313
1055+g, tdbSNP:376485138
1064+c, tdbSNP:369883604
1066+a, tdbSNP:185673395
1067+c, tdbSNP:190584029
1079+a, cdbSNP:5751602
1093+a, gdbSNP:148370562
1109+c, tdbSNP:373545962
1127+c, tdbSNP:143556635
1151+c, gdbSNP:200215919
1158+c, tdbSNP:200623759
1194+a, gdbSNP:141546043
1202+c, tdbSNP:147507158
1232+c, tdbSNP:147251834
1233+, adbSNP:35448298
1241+c, tdbSNP:368866486
1257+g, tdbSNP:41277529
1280+a, gdbSNP:372574844
1289+c, tdbSNP:149768123
1300+c, tdbSNP:201471497
1319+c, tdbSNP:147209807
1356+c, tdbSNP:376370758
1358+c, tdbSNP:370993449
1361+c, tdbSNP:148481144
1418+a, gdbSNP:34437269
1420+a, cdbSNP:370757682
1421+a, gdbSNP:74509390
1424+c, tdbSNP:374270061
1430+c, gdbSNP:377400067
1439+c, gdbSNP:371209281
1471+a, gdbSNP:200970605
1480+a, cdbSNP:372716390
1501+c, gdbSNP:200084988
1518+c, tdbSNP:35536098
1532+a, cdbSNP:201475311
1550+c, tdbSNP:144639320
1579+a, gdbSNP:377165672
1600+a, gdbSNP:199978062
1619+c, tdbSNP:146690317
1633+c, tdbSNP:140119537
1658+c, gdbSNP:370557490
1705+c, tdbSNP:150295769
1707+c, tdbSNP:373071713
complement(1714)-g, adbSNP:75489603
1717+c, gdbSNP:376162963
1723+a, cdbSNP:370770316
1738+a, gdbSNP:138970278
1747+c, tdbSNP:374432951
1780..1781+, cdbSNP:34361676
1780+g, tdbSNP:149419186
1783+c, tdbSNP:147089762
1791+c, gdbSNP:138456927
1802+c, tdbSNP:143923270
1810..1811+, gdbSNP:35866798
1824+a, gdbSNP:372259892
1835+c, gdbSNP:56321828
1847..1848+, gdbSNP:34195371
1851+a, gdbSNP:140632061
1863+c, tdbSNP:199823582
1871+c, gdbSNP:375509594
1879+dbSNP:
1879+a, gdbSNP:369217201
1882+c, tdbSNP:182865213
1886+c, tdbSNP:56092735
1904+c, tdbSNP:373981091
1921+a, gdbSNP:141440561
1935+c, tdbSNP:368824679
1939+a, gdbSNP:370367734
1963+a, c, tdbSNP:113693210
1964+c, tdbSNP:55938746
1973+a, gdbSNP:113473889
2006+c, tdbSNP:60094959
2009+a, gdbSNP:377682973
2023+c, tdbSNP:371224222
2024+a, gdbSNP:139201536
2057+a, gdbSNP:201526307
2068+dbSNP:
2068+a, gdbSNP:367931519
2105+a, c, gdbSNP:144134677
2141+c, tdbSNP:146490261
2180+dbSNP:
2180+a, gdbSNP:139936800
2184+g, tdbSNP:372400075
2201+c, gdbSNP:200769508
2204+a, gdbSNP:143350981
2231+c, tdbSNP:145536812
2256+c, tdbSNP:148847470
2257+a, gdbSNP:200190160
2269+a, cdbSNP:4437065
2305+a, gdbSNP:201937904
2330+c, tdbSNP:373937043
2348+a, gdbSNP:142514342
2364+dbSNP:
2364+a, gdbSNP:200379861
2371+a, gdbSNP:370028734
2378+c, tdbSNP:150919880
2399+a, cdbSNP:201963169
2411+c, tdbSNP:368430607
2431+a, gdbSNP:140626917
2453+c, tdbSNP:375042817
2473+dbSNP:
2473+a, gdbSNP:147105969
2485+c, gdbSNP:138532078
2497+c, tdbSNP:201579887
2549+dbSNP:
2549+a, gdbSNP:377473236
2564+a, cdbSNP:199708821
2658+dbSNP:
2658+a, gdbSNP:376536392
2683+a, gdbSNP:142568943
2690+c, tdbSNP:115274455
2696+a, gdbSNP:34646520
2750+dbSNP:
2750+g, tdbSNP:149366459
2778+a, gdbSNP:201000585
2816+c, gdbSNP:144690344
2839+dbSNP:
2839+c, tdbSNP:189814131
2852+a, cdbSNP:12484731
2863+a, gdbSNP:182714218
2865+a, gdbSNP:376466823
2866+g, tdbSNP:142746601
2869+c, gdbSNP:146038580
2870+a, gdbSNP:35727393
2876+a, gdbSNP:373574637
2889+c, tdbSNP:11558699
2890+a, gdbSNP:376680676
2937+a, gdbSNP:143418896
2940+a, gdbSNP:369826569
2961+a, gdbSNP:369754347
2970+a, tdbSNP:373315288
2983+a, gdbSNP:140504
3028+dbSNP:
3028+c, tdbSNP:367999645
3029+a, gdbSNP:147018000
3069+c, tdbSNP:376429312
3109+g, tdbSNP:369688527
3117+a, gdbSNP:371994625
3152+dbSNP:
3152+c, tdbSNP:55750699
3157+a, gdbSNP:372445084
3192+a, cdbSNP:149898233
3218+dbSNP:
3218+a, gdbSNP:144902732
3225+a, gdbSNP:368767652
3251+g, tdbSNP:141997637
3284+a, gdbSNP:56090728
3296+c, tdbSNP:2227939
3316+dbSNP:
3316+c, tdbSNP:201711782
3325+a, gdbSNP:35537221
3349+a, tdbSNP:142630372
3389+dbSNP:
3389+c, tdbSNP:370458655
3404+c, tdbSNP:181534426
3441+a, gdbSNP:2229038
3473+c, tdbSNP:55947542
3485+dbSNP:
3485+a, gdbSNP:11558694
3519+a, gdbSNP:370103167
3524+c, tdbSNP:375780906
3596+dbSNP:
3596+a, gdbSNP:201305382
3671+dbSNP:
3671+c, tdbSNP:138762891
3674+c, tdbSNP:141798488
3675+a, gdbSNP:372157539
3686+c, tdbSNP:144561126
3698+a, cdbSNP:148447062
3716+a, gdbSNP:141727669
3738..3739+, ccggdbSNP:372013175
3775+c, tdbSNP:11558696
3782+c, tdbSNP:144244878
3783+a, gdbSNP:147761005
3797+dbSNP:
3797+c, tdbSNP:11558697
3815+c, tdbSNP:149842523
3844+c, tdbSNP:35812689
3909+a, gdbSNP:200099830
3932+dbSNP:
3932+c, tdbSNP:370401626
3935+a, gdbSNP:374074883
3966+c, tdbSNP:200185744
4029+dbSNP:
4029+a, gdbSNP:55816482
4043+a, gdbSNP:55994703
4046+a, gdbSNP:55857020
4061+c, tdbSNP:143761574
4062+a, cdbSNP:146588912
4065+c, tdbSNP:367791049
4073+c, tdbSNP:56044087
4075+c, gdbSNP:56265970
4079+a, g, tdbSNP:56365112
4082+c, gdbSNP:56183727
4088+c, tdbSNP:138796724
4102+a, gdbSNP:141870546
4109+c, tdbSNP:371741091
4122+a, gdbSNP:376756021
4148+c, tdbSNP:55715766
4149+a, gdbSNP:369233532
4167+a, tdbSNP:55719322
4187+c, tdbSNP:56081881
4194+dbSNP:
4194+c, gdbSNP:138076353
4196+c, gdbSNP:149522895
4235+c, tdbSNP:73152683
4237+c, tdbSNP:2227942
4238+a, gdbSNP:180782611
4274+a, tdbSNP:201098494
4305+c, tdbSNP:142030544
4306+a, gdbSNP:180812
4311+c, gdbSNP:371040166
4337+a, gdbSNP:77227437
4391+g, tdbSNP:139707812
4445+a, gdbSNP:392389
4446+a, cdbSNP:440531
4452..4453+c, tdbSNP:9155
4452+c, tdbSNP:16999881
4510+c, tdbSNP:113629387
4537+a, gdbSNP:28379041
4541+g, tdbSNP:28573708
4551+a, gdbSNP:180816
4577+a, gdbSNP:1042660
4578+a, gdbSNP:180817
4595..4596+, tadbSNP:374974844
4603+c, tdbSNP:148871991
4618+c, gdbSNP:376819733
4619+a, gdbSNP:73390614
4634+a, tdbSNP:75677085
4665+c, tdbSNP:142419707
4696+c, tdbSNP:377423326
4722+a, gdbSNP:16999971
4779+c, gdbSNP:373651654
4787+a, cdbSNP:185140678
4788+g, tdbSNP:188387429
4808+a, gdbSNP:200139468
4824+c, tdbSNP:370544892
4845..4846+, tgcdbSNP:202178919
4847+g, tdbSNP:200759120
4850..4851+, cttdbSNP:199982774
4857+c, tdbSNP:201688596
4897+a, gdbSNP:112916839
4916+a, gdbSNP:368498986
4932+c, tdbSNP:200271725
4939+c, tdbSNP:181217014
4943+a, gdbSNP:141268094
4984+c, tdbSNP:368449049
5098+a, gdbSNP:17000103
5210+c, tdbSNP:112060998
5210+c, tdbSNP:376657976
complement(5276)-c, adbSNP:710189
5276+g, tdbSNP:62219816
complement(5306)-g, adbSNP:3876093
5309+c, gdbSNP:4049747
5340+a, gdbSNP:3876062
5354+a, gdbSNP:201499282
5379+a, gdbSNP:200955759
5384+c, tdbSNP:369607920
5393+a, gdbSNP:180821
5480+c, tdbSNP:3876064
5481+c, gdbSNP:201334111
5482+g, tdbSNP:5759700
5507+a, tdbSNP:200480301
5519+a, gdbSNP:712967
5539+c, tdbSNP:204705
5547+a, gdbSNP:11912264
5562+c, tdbSNP:6003613
5564+c, gdbSNP:150634731
5567+c, tdbSNP:370383730
5572+a, gdbSNP:28694179
5583+c, tdbSNP:9612292
5614+a, gdbSNP:3876065
5639+c, tdbSNP:5759705
5652+c, gdbSNP:4050443
5728+c, gdbSNP:550197
5730+c, tdbSNP:185660710
5731+a, gdbSNP:28451814
5841+a, cdbSNP:180823
5915+a, gdbSNP:77060940
5929+c, tdbSNP:4049754
5929+c, tdbSNP:191796388
5933+g, tdbSNP:143513163
5939+c, tdbSNP:28376962
5990..5991+, agdbSNP:200024571
5991..5992+, agdbSNP:371796933
6104+c, tdbSNP:28650060
6104+c, tdbSNP:62219817
6114+c, tdbSNP:9612580
6152+a, gdbSNP:78499455
6187+c, tdbSNP:199999533
6195+c, gdbSNP:28587260
6195+c, gdbSNP:200922215
6214+a, gdbSNP:201921384
6320+a, gdbSNP:199867487
6354+c, gdbSNP:149275
6354+c, gdbSNP:201149298
6435+a, gdbSNP:3869874
6435+c, tdbSNP:202061168
6487+a, gdbSNP:180826
6487+a, gdbSNP:200592947
complement(6546)-t, cdbSNP:3680
6565+c, tdbSNP:200871402
6581+a, gdbSNP:180828
Gene SymbolBCR
Gene SynonymALL; BCR1; CML; D22S11; D22S662; PHL
Chromosome22
Locus Map22q11.23
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_021574 Homo sapiens breakpoint cluster region (BCR), transcript variant 2, mRNA. On-demand TBD TBD
NM_004327 Homo sapiens breakpoint cluster region (BCR), transcript variant 1, mRNA. On-demand TBD TBD
Title Molecular dynamics reveal BCR-ABL1 polymutants as a unique mechanism of resistance to PAN-BCR-ABL1 kinase inhibitor therapy .
Author Gibbons DL, Pricl S, Posocco P, Laurini E, Fermeglia M, Sun H, Talpaz M, Donato N and Quintas-Cardama A.
Journal Proc. Natl. Acad. Sci. U.S.A. 111 (9), 3550-3555 (2014)
Title Single-cell analysis of K562 cells: an imatinib-resistant subpopulation is adherent and has upregulated expression of BCR-ABL mRNA and protein .
Author Karimiani EG, Marriage F, Merritt AJ, Burthem J, Byers RJ and Day PJ.
Journal Exp. Hematol. 42 (3), 183-191 (2014)
Title Molecular analysis of the BCR-ABL1 kinase domain in chronic-phase chronic myelogenous leukemia treated with tyrosine kinase inhibitors in practice: study by the Nagasaki CML Study Group .
Author Itonaga H, Tsushima H, Imanishi D, Hata T, Doi Y, Mori S, Sasaki D, Hasegawa H, Matsuo E, Nakashima J, Kato T, Horai M, Taguchi M, Matsuo M, Taniguchi H, Makiyama J, Sato S, Horio K, Ando K, Moriwaki Y, Sawayama Y, Ogawa D, Yamasaki R, Takasaki Y, Imaizumi Y, Taguchi J, Kawaguchi Y, Yoshida S, Joh T, Moriuchi Y, Nonaka H, Soda H, Fukushima T, Nagai K, Kamihira S, Tomonaga M, Yanagihara K and Miyazaki Y.
Journal Leuk. Res. 38 (1), 76-83 (2014)
Title Independent prognostic value of BCR-ABL1-like signature and IKZF1 deletion, but not high CRLF2 expression, in children with B-cell precursor ALL .
Author van der Veer A, Waanders E, Pieters R, Willemse ME, Van Reijmersdal SV, Russell LJ, Harrison CJ, Evans WE, van der Velden VH, Hoogerbrugge PM, Van Leeuwen F, Escherich G, Horstmann MA, Mohammadi Khankahdani L, Rizopoulos D, De Groot-Kruseman HA, Sonneveld E, Kuiper RP and Den Boer ML.
Journal Blood 122 (15), 2622-2629 (2013)
Title Dissection of the BCR-ABL signaling network using highly specific monobody inhibitors to the SHP2 SH2 domains .
Author Sha F, Gencer EB, Georgeon S, Koide A, Yasui N, Koide S and Hantschel O.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (37), 14924-14929 (2013)
Title Amplification and sequencing of genomic breakpoints located within the M-bcr region by Vectorette-mediated polymerase chain reaction .
Author Mills KI, Sproul AM, Ogilvie D, Elvin P, Leibowitz D and Burnett AK.
Journal Leukemia 6 (5), 481-483 (1992)
Title Locating protein-coding regions in human DNA sequences by a multiple sensor-neural network approach .
Author Uberbacher EC and Mural RJ.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (24), 11261-11265 (1991)
Title The BCR gene encodes a novel serine/threonine kinase activity within a single exon .
Author Maru Y and Witte ON.
Journal Cell 67 (3), 459-468 (1991)
Title BCR sequences essential for transformation by the BCR-ABL oncogene bind to the ABL SH2 regulatory domain in a non-phosphotyrosine-dependent manner .
Author Pendergast AM, Muller AJ, Havlik MH, Maru Y and Witte ON.
Journal Cell 66 (1), 161-171 (1991)
Title Reconstruction and analysis of human Alu genes .
Author Jurka J and Milosavljevic A.
Journal J. Mol. Evol. 32 (2), 105-121 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.