• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens heparanase 2 (inactive) (HPSE2), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu24543 Homo sapiens heparanase 2 (inactive) (HPSE2), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu24543C Homo sapiens heparanase 2 (inactive) (HPSE2), transcript variant 1, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_021828.4, 261878500
Length 1779 bp
Structure linear
Update Date 14-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens heparanase 2 (inactive) (HPSE2), transcript variant 1, mRNA.
Product inactive heparanase-2 isoform 1
Comment

Summary: This gene encodes a heparanase enzyme. The encoded protein is a endoglycosidase that degrades heparin sulfate proteoglycans located on the extracellular matrix and cell surface. This protein may be involved in biological processes involving remodeling of the extracellular matrix including angiogenesis and tumor progression. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009].


Transcript Variant: This variant (1) encodes the longest isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_068600.4
CDS 74..1852
Misc Feature(1)71..73
Misc Feature(2)<647..1297
Misc Feature(3)<647..1297
Exon (1)1..363
Gene:HPSE2
Gene Synonym:HPA2; HPR2; UFS; UFS1
Exon (2)364..521
Gene:HPSE2
Gene Synonym:HPA2; HPR2; UFS; UFS1
Exon (3)522..683
Gene:HPSE2
Gene Synonym:HPA2; HPR2; UFS; UFS1
Exon (4)684..857
Gene:HPSE2
Gene Synonym:HPA2; HPR2; UFS; UFS1
Exon (5)858..1029
Gene:HPSE2
Gene Synonym:HPA2; HPR2; UFS; UFS1
Exon (6)1030..1077
Gene:HPSE2
Gene Synonym:HPA2; HPR2; UFS; UFS1
Exon (7)1078..1171
Gene:HPSE2
Gene Synonym:HPA2; HPR2; UFS; UFS1
Exon (8)1172..1278
Gene:HPSE2
Gene Synonym:HPA2; HPR2; UFS; UFS1
Exon (9)1279..1393
Gene:HPSE2
Gene Synonym:HPA2; HPR2; UFS; UFS1
Exon (10)1394..1539
Gene:HPSE2
Gene Synonym:HPA2; HPR2; UFS; UFS1
Exon (11)1540..1686
Gene:HPSE2
Gene Synonym:HPA2; HPR2; UFS; UFS1
Exon (12)1687..4349
Gene:HPSE2
Gene Synonym:HPA2; HPR2; UFS; UFS1
Translation MRVLCAFPEAMPSSNSRPPACLAPGALYLALLLHLSLSSQAGDRRPLPVDRAAGLKEKTL ILLDVSTKNPVRTVNENFLSLQLDPSIIHDGWLDFLSSKRLVTLARGLSPAFLRFGGKRT DFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREK AAQMHLVLLKEQFSNTYSNLILTARSLDKLYNFADCSGLHLIFALNALRRNPNNSWNSSS ALSLLKYSASKKYNISWELGNEPNNYRTMHGRAVNGSQLGKDYIQLKSLLQPIRIYSRAS LYGPNIGRPRKNVIALLDGFMKVAGSTVDAVTWQHCYIDGRVVKVMDFLKTRLLDTLSDQ IRKIQKVVNTYTPGKKIWLEGVVTTSAGGTNNLSDSYAAGFLWLNTLGMLANQGIDVVIR HSFFDHGYNHLVDQNFNPLPDYWLSLLYKRLIGPKVLAVHVAGLQRKPRPGRVIRDKLRI YAHCTNHHNHNYVRGSITLFIINLHRSRKKIKLAGTLRDKLVHQYLLQPYGQEGLKSKSV QLNGQPLVMVDDGTLPELKPRPLRAGRTLVIPPVTMGFYVVKNVNALACRYR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(9)-dbSNP:
complement(9)-g, adbSNP:370179844
complement(39)-g, adbSNP:191143503
complement(84)-g, adbSNP:149915031
complement(90)-t, gdbSNP:139348877
complement(91)-g, adbSNP:368232122
complement(111)-g, adbSNP:202126356
complement(117)-t, cdbSNP:199876526
complement(123)-c, adbSNP:200747591
complement(128)-g, c, adbSNP:78935940
complement(135)-t, cdbSNP:143816972
complement(157)-g, adbSNP:200734371
complement(192)-t, g, cdbSNP:201180054
complement(200)-t, cdbSNP:139340706
complement(204)-t, cdbSNP:202168816
complement(218)-t, cdbSNP:199531515
complement(225)-c, adbSNP:368139705
complement(321)-t, adbSNP:374677794
complement(333)-g, adbSNP:140162468
complement(346)-t, gdbSNP:115042847
complement(455)-dbSNP:
complement(455)-g, adbSNP:11593055
complement(487)-t, cdbSNP:368698955
complement(493)-g, cdbSNP:200428269
complement(527)-dbSNP:
complement(527)-t, cdbSNP:201588272
530+c, tdbSNP:267606865
complement(565)-g, adbSNP:142763006
complement(595)-t, cdbSNP:200038077
complement(646)-t, cdbSNP:148098032
complement(649)-t, cdbSNP:373488450
complement(704)-dbSNP:
complement(704)-g, adbSNP:147866530
complement(759)-g, cdbSNP:373252593
complement(762)-t, cdbSNP:373235110
complement(771)-t, cdbSNP:149384712
complement(786)-t, cdbSNP:138827531
complement(800)-t, adbSNP:188784527
complement(863)-dbSNP:
complement(863)-t, cdbSNP:370999978
complement(877)-g, adbSNP:374885771
complement(888)-t, cdbSNP:376543806
complement(908)-g, adbSNP:374153380
complement(953)-g, adbSNP:370784296
complement(955)-c, adbSNP:202038196
complement(968)-t, cdbSNP:142102360
complement(1000)-t, cdbSNP:200916817
complement(1015)-g, cdbSNP:142810016
complement(1016)-t, cdbSNP:17110744
complement(1019)-g, adbSNP:146258153
complement(1095)-dbSNP:
complement(1095)-t, cdbSNP:140694252
complement(1128)-t, cdbSNP:150939842
complement(1144)-g, cdbSNP:377253454
complement(1146)-g, cdbSNP:372269653
complement(1227)-dbSNP:
complement(1227)-g, adbSNP:200583760
complement(1241)-t, cdbSNP:146794713
complement(1255)-g, cdbSNP:372169556
complement(1267)-g, adbSNP:111762231
complement(1280)-dbSNP:
complement(1280)-g, adbSNP:148842469
complement(1308)-t, cdbSNP:373684212
complement(1316)-t, cdbSNP:199706656
complement(1331)-g, adbSNP:371339829
complement(1375)-c, adbSNP:368520061
complement(1421)-dbSNP:
complement(1421)-g, adbSNP:200599636
complement(1430)-t, cdbSNP:372483147
complement(1465)-g, cdbSNP:146698468
complement(1476)-g, adbSNP:143754332
complement(1480)-t, cdbSNP:201908403
1487+c, g, tdbSNP:267606864
complement(1497)-t, cdbSNP:368857672
complement(1501)-g, adbSNP:141037591
complement(1527)-t, gdbSNP:78773769
1538..1539+, aadbSNP:397515338
complement(1539)-t, cdbSNP:199616956
complement(1549)-dbSNP:
complement(1549)-g, adbSNP:140154839
complement(1550)-t, cdbSNP:146633667
complement(1553)-g, adbSNP:144545292
complement(1554)-t, c, adbSNP:200525907
complement(1555)-g, adbSNP:369149907
complement(1562)-t, cdbSNP:139242637
1589+c, tdbSNP:267606866
complement(1604)-t, cdbSNP:150817364
complement(1657)-t, cdbSNP:372194163
complement(1665)-t, cdbSNP:141422695
complement(1691)-dbSNP:
complement(1691)-g, cdbSNP:140066668
1701+a, tdbSNP:397515452
complement(1712)-g, adbSNP:147273039
complement(1726)-g, adbSNP:142803464
complement(1729)-g, adbSNP:202127938
complement(1740)-g, adbSNP:138866975
complement(1754)-t, gdbSNP:201787008
complement(1763)-g, adbSNP:373432908
complement(1772)-g, adbSNP:146116710
complement(1777)-t, cdbSNP:371089049
complement(1780)-g, cdbSNP:377504467
complement(1798)-g, adbSNP:373037328
complement(1809)-t, adbSNP:10883100
complement(1827)-t, cdbSNP:370822615
complement(1842)-t, cdbSNP:138098027
complement(1847)-g, adbSNP:369345201
complement(1860)-c, adbSNP:374731987
complement(1861)-g, cdbSNP:371322055
complement(1869)-g, adbSNP:10883099
complement(1877)-t, cdbSNP:376767710
complement(1909)-g, adbSNP:151176990
complement(1921)-t, gdbSNP:35712968
complement(1939)-g, cdbSNP:190228332
complement(2002)-t, gdbSNP:60830323
complement(2078)-t, cdbSNP:148675038
complement(2117)-g, adbSNP:112735875
complement(2122)-t, adbSNP:114885354
complement(2131)-t, cdbSNP:377352426
complement(2138)-g, adbSNP:184546216
complement(2288)-t, gdbSNP:17457493
complement(2297)-t, cdbSNP:192218941
2308+c, tdbSNP:146000087
2417+a, gdbSNP:1060445
complement(2417)-t, cdbSNP:386514525
complement(2429)-t, cdbSNP:367720244
2451+c, tdbSNP:3179357
2462+c, gdbSNP:1060446
complement(2487)-g, adbSNP:144073598
complement(2491)-g, cdbSNP:139422316
2651+a, gdbSNP:1060447
complement(2730..2731)-, gtdbSNP:373079681
complement(2798)-t, cdbSNP:116701075
complement(2801)-g, adbSNP:10786427
complement(2850)-t, cdbSNP:17109911
complement(2852)-g, adbSNP:114591152
complement(2904..2905)-, adbSNP:34790086
complement(2988)-g, cdbSNP:10883098
complement(3124)-c, adbSNP:4917836
complement(3160)-t, cdbSNP:11593448
complement(3166)-g, adbSNP:12269710
complement(3192)-t, gdbSNP:186589995
complement(3211)-t, cdbSNP:4917835
complement(3217..3218)-, tdbSNP:140887054
complement(3253)-g, adbSNP:11599904
complement(3259)-g, cdbSNP:75115624
complement(3304)-g, adbSNP:4917834
complement(3375)-t, cdbSNP:4917833
complement(3375)-g, adbSNP:111184991
complement(3444)-g, cdbSNP:4917832
complement(3454)-t, cdbSNP:184120747
complement(3490..3491)-tg, cadbSNP:386746907
complement(3490)-g, adbSNP:58534010
complement(3491)-t, cdbSNP:4917831
complement(3574)-c, adbSNP:75584607
complement(3611)-g, adbSNP:4919228
complement(3663)-g, adbSNP:59842719
complement(3684)-c, adbSNP:150649341
complement(3716)-g, adbSNP:141887539
complement(3754)-t, cdbSNP:370801066
complement(3765)-t, cdbSNP:191656902
complement(3813)-g, adbSNP:376484558
complement(3939)-t, cdbSNP:74902668
complement(3976)-t, cdbSNP:10786426
complement(3985)-g, adbSNP:377479809
complement(4006)-g, adbSNP:74156611
complement(4031)-g, adbSNP:117572970
complement(4033)-g, cdbSNP:148152580
complement(4037)-t, cdbSNP:12778249
complement(4209)-t, adbSNP:78986047
complement(4210)-t, adbSNP:75469488
complement(4218..4219)-, adbSNP:143986616
complement(4285)-g, cdbSNP:4611143
Gene SymbolHPSE2
Gene SynonymHPA2; HPR2; UFS; UFS1
Chromosome10
Locus Map10q23-q24
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_021828 Homo sapiens heparanase 2 (inactive) (HPSE2), transcript variant 1, mRNA. On-demand $219.00 7-9
NM_021828 Homo sapiens heparanase 2 (inactive) (HPSE2), transcript variant 1, mRNA. On-demand $219.00 7-9
NM_021828 Homo sapiens heparanase 2 (inactive) (HPSE2), transcript variant 1, mRNA. On-demand $219.00 7-9
NM_021828 Homo sapiens heparanase 2 (inactive) (HPSE2), transcript variant 1, mRNA. On-demand $219.00 7-9
NM_021828 Homo sapiens heparanase 2 (inactive) (HPSE2), transcript variant 1, mRNA. On-demand $219.00 7-9
Title Genome-wide meta-analysis identifies new susceptibility loci for migraine .
Author Anttila V, Winsvold BS, Gormley P, Kurth T, Bettella F, McMahon G, Kallela M, Malik R, de Vries B, Terwindt G, Medland SE, Todt U, McArdle WL, Quaye L, Koiranen M, Ikram MA, Lehtimaki T, Stam AH, Ligthart L, Wedenoja J, Dunham I, Neale BM, Palta P, Hamalainen E, Schurks M, Rose LM, Buring JE, Ridker PM, Steinberg S, Stefansson H, Jakobsson F, Lawlor DA, Evans DM, Ring SM, Farkkila M, Artto V, Kaunisto MA, Freilinger T, Schoenen J, Frants RR, Pelzer N, Weller CM, Zielman R, Heath AC, Madden PA, Montgomery GW, Martin NG, Borck G, Gobel H, Heinze A, Heinze-Kuhn K, Williams FM, Hartikainen AL, Pouta A, van den Ende J, Uitterlinden AG, Hofman A, Amin N, Hottenga JJ, Vink JM, Heikkila K, Alexander M, Muller-Myhsok B, Schreiber S, Meitinger T, Wichmann HE, Aromaa A, Eriksson JG, Traynor BJ, Trabzuni D, Rossin E, Lage K, Jacobs SB, Gibbs JR, Birney E, Kaprio J, Penninx BW, Boomsma DI, van Duijn C, Raitakari O, Jarvelin MR, Zwart JA, Cherkas L, Strachan DP, Kubisch C, Ferrari MD, van den Maagdenberg AM, Dichgans M, Wessman M, Smith GD, Stefansson K, Daly MJ, Nyholt DR, Chasman DI and Palotie A.
Journal Nat. Genet. 45 (8), 912-917 (2013)
Title Expression of heparanase isoforms in intervertebral discs classified according to Pfirrmann grading system for disc degeneration .
Author Rodrigues LM, Oliveira LZ and Pinhal MA.
Journal Spine 38 (13), 1112-1118 (2013)
Title Rank-based genome-wide analysis reveals the association of ryanodine receptor-2 gene variants with childhood asthma among human populations .
Author Ding L, Abebe T, Beyene J, Wilke RA, Goldberg A, Woo JG, Martin LJ, Rothenberg ME, Rao M, Hershey GK, Chakraborty R and Mersha TB.
Journal Hum. Genomics 7, 16 (2013)
Title Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population .
Author Comuzzie AG, Cole SA, Laston SL, Voruganti VS, Haack K, Gibbs RA and Butte NF.
Journal PLoS ONE 7 (12), E51954 (2012)
Title A genome-wide meta-analysis of six type 1 diabetes cohorts identifies multiple associated loci .
Author Bradfield JP, Qu HQ, Wang K, Zhang H, Sleiman PM, Kim CE, Mentch FD, Qiu H, Glessner JT, Thomas KA, Frackelton EC, Chiavacci RM, Imielinski M, Monos DS, Pandey R, Bakay M, Grant SF, Polychronakos
Journal PLoS Genet. 7 (9), E1002293 (2011)
Title Cloning and expression profiling of Hpa2, a novel mammalian heparanase family member .
Author McKenzie E, Tyson K, Stamps A, Smith P, Turner P, Barry R, Hircock M, Patel S, Barry E, Stubberfield C, Terrett J and Page M.
Journal Biochem. Biophys. Res. Commun. 276 (3), 1170-1177 (2000)
Title Construction of a physical and transcript map for a 1-Mb genomic region containing the urofacial (Ochoa) syndrome gene on 10q23-q24 and localization of the disease gene within two overlapping BAC clones (<360 kb) .
Author Wang CY, Shi JD, Huang YQ, Cruz PE, Ochoa B, Hawkins-Lee B, Davoodi-Semiromi A and She JX.
Journal Genomics 60 (1), 12-19 (1999)
Title Genetic homogeneity, high-resolution mapping, and mutation analysis of the urofacial (Ochoa) syndrome and exclusion of the glutamate oxaloacetate transaminase gene (GOT1) in the critical region as the disease gene .
Author Wang CY, Huang YQ, Shi JD, Marron MP, Ruan QG, Hawkins-Lee B, Ochoa
Journal Am. J. Med. Genet. 84 (5), 454-459 (1999)
Title Homozygosity and linkage-disequilibrium mapping of the urofacial (Ochoa) syndrome gene to a 1-cM interval on chromosome 10q23-q24 .
Author Wang CY, Hawkins-Lee B, Ochoa B, Walker RD and She JX.
Journal Am. J. Hum. Genet. 60 (6), 1461-1467 (1997)
Title Urofacial Syndrome .
Author Newman,W.G., Woolf,A.S. and Stuart,H.M.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.