• THAT   AND
  • THAT   AND


Homo sapiens ALX homeobox 4 (ALX4), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_021926 Homo sapiens ALX homeobox 4 (ALX4), mRNA. Full Lenth $2459.70
ORF Sequence $358.44


RefSeq Version NM_021926.3, 261245049
Length 5466 bp
Structure linear
Update Date 13-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens ALX homeobox 4 (ALX4), mRNA.
Product homeobox protein aristaless-like 4
Comment

Summary: This gene encodes a paired-like homeodomain transcription factor expressed in the mesenchyme of developing bones, limbs, hair, teeth, and mammary tissue. Mutations in this gene cause parietal foramina 2 (PFM2); an autosomal dominant disease characterized by deficient ossification of the parietal bones. Mutations in this gene also cause a form of frontonasal dysplasia with alopecia and hypogonadism; suggesting a role for this gene in craniofacial development, mesenchymal-epithelial communication, and hair follicle development. Deletion of a segment of chromosome 11 containing this gene, del(11)(p11p12), causes Potocki-Shaffer syndrome (PSS); a syndrome characterized by craniofacial anomalies, mental retardation, multiple exostoses, and genital abnormalities in males. In mouse, this gene has been shown to use dual translation initiation sites located 16 codons apart. [provided by RefSeq].


Sequence Note: The RefSeq transcript and protein were derived from transcript and genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_068745.2
CDS 105..1340
Exon (1)1..570
Exon (2)1..570
Exon (3)571..881
Exon (4)882..1010
Exon (5)1011..5466
Translation MNAETCVSYCESPAAAMDAYYSPVSQSREGSSPFRAFPGGDKFGTTFLSAAAKAQGFGDA KSRARYGAGQQDLATPLESGAGARGSFNKFQPQPSTPQPQPPPQPQPQQQQPQPQPPAQP HLYLQRGACKTPPDGSLKLQEGSSGHSAALQVPCYAKESSLGEPELPPDSDTVGMDSSYL SVKEAGVKGPQDRASSDLPSPLEKADSESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPD VYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFSTAYELPLLTRAENY AQIQNPSWLGNNGAASPVPACVVPCDPVPACMSPHAHPPGSGASSVTDFLSVSGAGSHVG QTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMKAKEHSAAISWAT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(14)-t, gdbSNP:116381450
complement(167)-g, adbSNP:61737298
complement(173)-g, cdbSNP:115968657
208+c, gdbSNP:3824915
complement(330)-t, gdbSNP:79200219
complement(408)-g, adbSNP:12421995
522+c, tdbSNP:104894191
complement(698)-t, gdbSNP:61737295
724+a, cdbSNP:104894197
complement(725)-t, cdbSNP:10769028
757+a, gdbSNP:104894193
complement(833)-t, cdbSNP:11037928
840+c, tdbSNP:104894192
complement(843)-t, gdbSNP:78898605
919+c, gdbSNP:104894196
complement(983)-g, adbSNP:12419361
1178+c, tdbSNP:3802805
complement(1189)-g, adbSNP:61737293
1250+c, tdbSNP:355697
complement(1386)-t, cdbSNP:72905941
complement(1537..1538)-, gdbSNP:34142561
complement(1568)-g, adbSNP:4755798
complement(1606)-c, adbSNP:60998360
complement(1630)-g, adbSNP:7128671
complement(1712)-t, cdbSNP:113482355
complement(1764..1765)-, gdbSNP:113592690
complement(1857)-g, adbSNP:4755797
complement(1887)-t, cdbSNP:4755796
2053+a, c, g, tdbSNP:410592
2054+c, gdbSNP:454205
complement(2147)-t, cdbSNP:117892081
complement(2242)-t, cdbSNP:76229477
complement(2262)-c, adbSNP:116759460
complement(2263)-g, adbSNP:115353803
complement(2313)-t, cdbSNP:117526668
complement(2471)-g, adbSNP:10458913
complement(2567)-t, cdbSNP:76501131
complement(2685)-t, cdbSNP:113781536
complement(2787)-t, cdbSNP:11037920
complement(2902)-g, cdbSNP:111964563
complement(3039)-c, adbSNP:7942612
complement(3053)-g, cdbSNP:76845793
complement(3236)-t, cdbSNP:55959427
complement(3241)-t, cdbSNP:78007447
complement(3342..3343)-, gdbSNP:35568325
complement(3450)-t, cdbSNP:7105993
complement(3566)-t, cdbSNP:78607024
complement(3574)-g, adbSNP:74847335
3819+c, tdbSNP:897004
complement(3847)-t, cdbSNP:75369525
complement(3994)-t, cdbSNP:112232037
4022+c, tdbSNP:897005
complement(4168)-g, adbSNP:77015141
4172+a, cdbSNP:1840254
4285+a, gdbSNP:373283
4286+a, gdbSNP:453267
complement(4352)-g, cdbSNP:117877500
complement(4447)-t, cdbSNP:4755239
complement(4506)-g, adbSNP:7116335
complement(4575)-t, cdbSNP:4755238
complement(4629)-c, adbSNP:114477055
complement(4739)-t, gdbSNP:113734133
complement(4745)-t, cdbSNP:7115841
complement(4936)-g, cdbSNP:11037919
complement(5109)-g, adbSNP:116662493
complement(5113)-t, cdbSNP:114755169
complement(5458..5459)-, adbSNP:34557775
Gene SymbolALX4
Gene SynonymFND2; KIAA1788
Chromosome11
Locus Map11p11.2
All Transcripts NM_021926
Title Impact of single nucleotide polymorphisms and of clinical risk factors on new-onset diabetes mellitus in HIV-infected individuals .
Author Rotger,M., Gsponer,T., Martinez,R., Taffe,P., Elzi,L., Vernazza,P., Cavassini,M., Bernasconi,E., Hirschel,B., Furrer,H., Weber,R., Ledergerber,B., Egger,M., Telenti,A. and Tarr,P.E.
Journal Clin. Infect. Dis. 51 (9), 1090-1098 (2010)
Title HoxB2, HoxB4 and Alx4 genes are downregulated in the cadmium-induced omphalocele in the chick model .
Author Doi,T., Puri,P., Bannigan,J. and Thompson,J.
Journal Pediatr. Surg. Int. 26 (10), 1017-1023 (2010)
Title Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia .
Author Jugessur,A., Shi,M., Gjessing,H.K., Lie,R.T., Wilcox,A.J., Weinberg,C.R., Christensen,K., Boyles,A.L., Daack-Hirsch,S., Nguyen,T.T., Christiansen,L., Lidral,A.C. and Murray,J.C.
Journal PLoS ONE 5 (7), E11493 (2010)
Title Performance of epigenetic markers SEPT9 and ALX4 in plasma for detection of colorectal precancerous lesions .
Author Tanzer,M., Balluff,B., Distler,J., Hale,K., Leodolter,A., Rocken,C., Molnar,B., Schmid,R., Lofton-Day,C., Schuster,T. and Ebert,M.P.
Journal PLoS ONE 5 (2), E9061 (2010)
Title Loss of ALX4 expression in epithelial cells and adjacent stromal cells in breast cancer .
Author Chang,H., Mohabir,N., Done,S. and Hamel,P.A.
Journal J. Clin. Pathol. 62 (10), 908-914 (2009)
Title The ALX4 homeobox gene is mutated in patients with ossification defects of the skull (foramina parietalia permagna, OMIM 168500) .
Author Wuyts,W., Cleiren,E., Homfray,T., Rasore-Quartino,A., Vanhoenacker,F. and Van Hul,W.
Journal J. Med. Genet. 37 (12), 916-920 (2000)
Title Haploinsufficiency of ALX4 as a potential cause of parietal foramina in the 11p11.2 contiguous gene-deletion syndrome .
Author Wu,Y.Q., Badano,J.L., McCaskill,C., Vogel,H., Potocki,L. and Shaffer,L.G.
Journal Am. J. Hum. Genet. 67 (5), 1327-1332 (2000)
Title Physical and genetic interactions between Alx4 and Cart1 .
Author Qu,S., Tucker,S.C., Zhao,Q., deCrombrugghe,B. and Wisdom,R.
Journal Development 126 (2), 359-369 (1999)
Title Delineation of a contiguous gene syndrome with multiple exostoses, enlarged parietal foramina, craniofacial dysostosis, and mental retardation, caused by deletions in the short arm of chromosome 11 .
Author Bartsch,O., Wuyts,W., Van Hul,W., Hecht,J.T., Meinecke,P., Hogue,D., Werner,W., Zabel,B., Hinkel,G.K., Powell,C.M., Shaffer,L.G. and Willems,P.J.
Journal Am. J. Hum. Genet. 58 (4), 734-742 (1996)
Title WAGR syndrome and multiple exostoses in a patient with del(11)(p11.2p14.2) .
Author McGaughran,J.M., Ward,H.B. and Evans,D.G.
Journal J. Med. Genet. 32 (10), 823-824 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878