• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_021955 Homo sapiens guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1), mRNA. GenEZ ORF Cloning In-stock $248.00 $199.00 10

*Business Day

Related Services

RefSeq Version NM_021955.3, 74316012
Length 628 bp
Structure linear
Update Date 18-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1), mRNA.
Product guanine nucleotide-binding protein G(T) subunit gamma-T1 precursor
Comment

Summary: Heterotrimeric guanine nucleotide-binding proteins (G proteins) transduce extracellular signals received by transmembrane receptors to effector proteins. Transducin is a guanine nucleotide-binding protein found specifically in rod outer segments, where it mediates activation by rhodopsin of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase. Transducin is also referred to as GMPase. GNGT1 encodes the gamma subunit of transducin (Hurley et al., 1984 [PubMed 6438626]; Scherer et al., 1996 [PubMed 8661128]).[supplied by OMIM, Mar 2008].

RefSeq NP_068774.1
CDS 149..373
Misc Feature(1)110..112
Misc Feature(2)182..352
Misc Feature(3)order(182..184,191..193,203..205,212..214,224..226,
Exon (1)1..137
Gene:GNGT1
Gene Synonym:GNG1
Exon (2)138..244
Gene:GNGT1
Gene Synonym:GNG1
Exon (3)245..628
Gene:GNGT1
Gene Synonym:GNG1
Translation MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED KNPFKELKGGCVIS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
80+dbSNP:
80+c, tdbSNP:147350641
157+a, gdbSNP:191685430
205+c, tdbSNP:150956934
209+c, gdbSNP:141065761
230+a, cdbSNP:200035274
244+a, gdbSNP:202009903
265+dbSNP:
265+a, gdbSNP:202213169
278+a, gdbSNP:149827734
282+a, gdbSNP:146833932
296+a, c, gdbSNP:17243826
307+a, gdbSNP:145866931
315+g, tdbSNP:138254553
340+a, cdbSNP:149136992
360+a, gdbSNP:143310057
398+a, cdbSNP:77925896
455+a, gdbSNP:115265988
464+a, gdbSNP:141229133
477+c, gdbSNP:79786664
491+a, c, g, tdbSNP:2798
Gene SymbolGNGT1
Gene SynonymGNG1
Chromosome7
Locus Map7q21.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_021955 Homo sapiens guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1), mRNA. In-stock $248.00 $199.00 10
Title Genome-wide association study of lung function decline in adults with and without asthma .
Author Imboden,M., Bouzigon,E., Curjuric,I., Ramasamy,A., Kumar,A., Hancock,D.B., Wilk,J.B., Vonk,J.M., Thun,G.A., Siroux,V., Nadif,R., Monier,F., Gonzalez,J.R., Wjst,M., Heinrich,J., Loehr,L.R., Franceschini,N., North,K.E., Altmuller,J., Koppelman,G.H., Guerra,S., Kronenberg,F., Lathrop,M., Moffatt,M.F., O'Connor,G.T., Strachan,D.P., Postma,D.S., London,S.J., Schindler,C., Kogevinas,M., Kauffmann,F., Jarvis,D.L., Demenais,F. and Probst-Hensch,N.M.
Journal J. Allergy Clin. Immunol. 129 (5), 1218-1228 (2012)
Title The WD40 repeat protein WDR26 binds Gbetagamma and promotes Gbetagamma-dependent signal transduction and leukocyte migration .
Author Sun,Z., Tang,X., Lin,F. and Chen,S.
Journal J. Biol. Chem. 286 (51), 43902-43912 (2011)
Title G protein betagamma subunits regulate cell adhesion through Rap1a and its effector Radil .
Author Ahmed,S.M., Daulat,A.M., Meunier,A. and Angers,S.
Journal J. Biol. Chem. 285 (9), 6538-6551 (2010)
Title G Protein betagamma subunits augment UVB-induced apoptosis by stimulating the release of soluble heparin-binding epidermal growth factor from human keratinocytes .
Author Seo,M., Lee,M.J., Heo,J.H., Lee,Y.I., Kim,Y., Kim,S.Y., Lee,E.S. and Juhnn,Y.S.
Journal J. Biol. Chem. 282 (34), 24720-24730 (2007)
Title Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins .
Author Fowler,C.E., Aryal,P., Suen,K.F. and Slesinger,P.A.
Journal J. Physiol. (Lond.) 580 (PT 1), 51-65 (2007)
Title Differential ability to form the G protein betagamma complex among members of the beta and gamma subunit families .
Author Yan,K., Kalyanaraman,V. and Gautam,N.
Journal J. Biol. Chem. 271 (12), 7141-7146 (1996)
Title Isolation of cDNA clones encoding eight different human G protein gamma subunits, including three novel forms designated the gamma 4, gamma 10, and gamma 11 subunits .
Author Ray,K., Kunsch,C., Bonner,L.M. and Robishaw,J.D.
Journal J. Biol. Chem. 270 (37), 21765-21771 (1995)
Title Structure of the bovine transducin gamma subunit gene and analysis of promoter function in transgenic mice .
Author Tao,L., Pandey,S., Simon,M.I. and Fong,H.K.
Journal Exp. Eye Res. 56 (4), 497-507 (1993)
Title G-protein beta gamma dimers. Membrane targeting requires subunit coexpression and intact gamma C-A-A-X domain .
Author Simonds,W.F., Butrynski,J.E., Gautam,N., Unson,C.G. and Spiegel,A.M.
Journal J. Biol. Chem. 266 (9), 5363-5366 (1991)
Title Isolation and characterization of a cDNA clone for the gamma subunit of bovine retinal transducin .
Author Hurley,J.B., Fong,H.K., Teplow,D.B., Dreyer,W.J. and Simon,M.I.
Journal Proc. Natl. Acad. Sci. U.S.A. 81 (22), 6948-6952 (1984)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.