• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu04853 Homo sapiens guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu04853C Homo sapiens guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_021955.3, 74316012
Length 225 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1), mRNA.
Product guanine nucleotide-binding protein G(T) subunit gamma-T1 precursor
Comment

Summary: Heterotrimeric guanine nucleotide-binding proteins (G proteins) transduce extracellular signals received by transmembrane receptors to effector proteins. Transducin is a guanine nucleotide-binding protein found specifically in rod outer segments, where it mediates activation by rhodopsin of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase. Transducin is also referred to as GMPase. GNGT1 encodes the gamma subunit of transducin (Hurley et al., 1984 [PubMed 6438626]; Scherer et al., 1996 [PubMed 8661128]).[supplied by OMIM, Mar 2008].

RefSeq NP_068774.1
CDS 149..373
Misc Feature(1)110..112
Misc Feature(2)182..352
Misc Feature(3)order(182..184,191..193,203..205,212..214,224..226,
Exon (1)1..137
Gene:GNGT1
Gene Synonym:GNG1
Exon (2)138..244
Gene:GNGT1
Gene Synonym:GNG1
Exon (3)245..628
Gene:GNGT1
Gene Synonym:GNG1
Translation MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED KNPFKELKGGCVIS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
80+dbSNP:
80+c, tdbSNP:147350641
80+c, tdbSNP:386465364
153+c, tdbSNP:376703142
157+a, gdbSNP:191685430
205+c, tdbSNP:150956934
209+c, gdbSNP:141065761
230+a, cdbSNP:200035274
244+a, gdbSNP:202009903
265+dbSNP:
265+a, gdbSNP:202213169
278+a, gdbSNP:149827734
282+a, gdbSNP:146833932
286+a, gdbSNP:374057761
296+a, c, gdbSNP:17243826
315+g, tdbSNP:138254553
340+a, cdbSNP:149136992
360+a, gdbSNP:143310057
361+c, tdbSNP:368033084
398+a, cdbSNP:77925896
406+a, cdbSNP:372563644
455+a, gdbSNP:115265988
complement(464)-g, adbSNP:141229133
477+c, gdbSNP:79786664
complement(491)-t, g, c, adbSNP:2798
531+c, tdbSNP:370988411
Gene SymbolGNGT1
Gene SynonymGNG1
Chromosome7
Locus Map7q21.3
Title IGF-1 activates a cilium-localized noncanonical Gbetagamma signaling pathway that regulates cell-cycle progression .
Author Yeh C, Li A, Chuang JZ, Saito M, Caceres A and Sung CH.
Journal Dev. Cell 26 (4), 358-368 (2013)
Title Genome-wide association study of lung function decline in adults with and without asthma .
Author Imboden M, Bouzigon E, Curjuric I, Ramasamy A, Kumar A, Hancock DB, Wilk JB, Vonk JM, Thun GA, Siroux V, Nadif R, Monier F, Gonzalez JR, Wjst M, Heinrich J, Loehr LR, Franceschini N, North KE, Altmuller J, Koppelman GH, Guerra S, Kronenberg F, Lathrop M, Moffatt MF, O'Connor GT, Strachan DP, Postma DS, London SJ, Schindler C, Kogevinas M, Kauffmann F, Jarvis DL, Demenais F and Probst-Hensch NM.
Journal J. Allergy Clin. Immunol. 129 (5), 1218-1228 (2012)
Title The WD40 repeat protein WDR26 binds Gbetagamma and promotes Gbetagamma-dependent signal transduction and leukocyte migration .
Author Sun Z, Tang X, Lin F and Chen S.
Journal J. Biol. Chem. 286 (51), 43902-43912 (2011)
Title G protein betagamma subunits regulate cell adhesion through Rap1a and its effector Radil .
Author Ahmed SM, Daulat AM, Meunier A and Angers S.
Journal J. Biol. Chem. 285 (9), 6538-6551 (2010)
Title G Protein betagamma subunits augment UVB-induced apoptosis by stimulating the release of soluble heparin-binding epidermal growth factor from human keratinocytes .
Author Seo M, Lee MJ, Heo JH, Lee YI, Kim Y, Kim SY, Lee ES and Juhnn YS.
Journal J. Biol. Chem. 282 (34), 24720-24730 (2007)
Title Differential ability to form the G protein betagamma complex among members of the beta and gamma subunit families .
Author Yan K, Kalyanaraman V and Gautam N.
Journal J. Biol. Chem. 271 (12), 7141-7146 (1996)
Title Isolation of cDNA clones encoding eight different human G protein gamma subunits, including three novel forms designated the gamma 4, gamma 10, and gamma 11 subunits .
Author Ray K, Kunsch C, Bonner LM and Robishaw JD.
Journal J. Biol. Chem. 270 (37), 21765-21771 (1995)
Title Structure of the bovine transducin gamma subunit gene and analysis of promoter function in transgenic mice .
Author Tao L, Pandey S, Simon MI and Fong HK.
Journal Exp. Eye Res. 56 (4), 497-507 (1993)
Title G-protein beta gamma dimers. Membrane targeting requires subunit coexpression and intact gamma C-A-A-X domain .
Author Simonds WF, Butrynski JE, Gautam N, Unson CG and Spiegel AM.
Journal J. Biol. Chem. 266 (9), 5363-5366 (1991)
Title Isolation and characterization of a cDNA clone for the gamma subunit of bovine retinal transducin .
Author Hurley,J.B., Fong,H.K., Teplow,D.B., Dreyer,W.J. and Simon,M.I.
Journal Proc. Natl. Acad. Sci. U.S.A. 81 (22), 6948-6952 (1984)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.