• THAT   AND
  • THAT   AND


Homo sapiens guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_021955 Homo sapiens guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1), mRNA. Full Lenth $182.12
ORF Sequence $159.00


RefSeq Version NM_021955.3, 74316012
Length 628 bp
Structure linear
Update Date 13-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 (GNGT1), mRNA.
Product guanine nucleotide-binding protein G(T) subunit gamma-T1 precursor
Comment

Summary: Heterotrimeric guanine nucleotide-binding proteins (G proteins) transduce extracellular signals received by transmembrane receptors to effector proteins. Transducin is a guanine nucleotide-binding protein found specifically in rod outer segments, where it mediates activation by rhodopsin of a cyclic GTP-specific (guanosine monophosphate) phosphodiesterase. Transducin is also referred to as GMPase. GNGT1 encodes the gamma subunit of transducin (Hurley et al., 1984 [PubMed 6438626]; Scherer et al., 1996 [PubMed 8661128]).[supplied by OMIM].

RefSeq NP_068774.1
CDS 149..373
Exon (1)1..137
Exon (2)1..137
Exon (3)138..244
Exon (4)245..628
Translation MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPED KNPFKELKGGCVIS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
296+a, c, gdbSNP:17243826
398+a, cdbSNP:77925896
455+a, gdbSNP:115265988
477+c, gdbSNP:79786664
complement(491)-t, gdbSNP:2798
Gene SymbolGNGT1
Gene SynonymGNG1
Chromosome7
Locus Map7q21.3
All Transcripts NM_021955
Title G protein betagamma subunits regulate cell adhesion through Rap1a and its effector Radil .
Author Ahmed,S.M., Daulat,A.M., Meunier,A. and Angers,S.
Journal J. Biol. Chem. 285 (9), 6538-6551 (2010)
Title G Protein betagamma subunits augment UVB-induced apoptosis by stimulating the release of soluble heparin-binding epidermal growth factor from human keratinocytes .
Author Seo,M., Lee,M.J., Heo,J.H., Lee,Y.I., Kim,Y., Kim,S.Y., Lee,E.S. and Juhnn,Y.S.
Journal J. Biol. Chem. 282 (34), 24720-24730 (2007)
Title Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins .
Author Fowler,C.E., Aryal,P., Suen,K.F. and Slesinger,P.A.
Journal J. Physiol. (Lond.) 580 (PT 1), 51-65 (2007)
Title Conditional stimulation of type V and VI adenylyl cyclases by G protein betagamma subunits .
Author Gao,X., Sadana,R., Dessauer,C.W. and Patel,T.B.
Journal J. Biol. Chem. 282 (1), 294-302 (2007)
Title [Analysis of GUCA1B,GNGT1 and RGS9 genes in patients with retinitis pigmentosa] .
Author Zhang,Q.J., Li,W., Xiao,X.S., Li,S.Q. and Guo,X.M.
Journal Yi Chuan 24 (1), 19-21 (2002)
Title Differential ability to form the G protein betagamma complex among members of the beta and gamma subunit families .
Author Yan,K., Kalyanaraman,V. and Gautam,N.
Journal J. Biol. Chem. 271 (12), 7141-7146 (1996)
Title Isolation of cDNA clones encoding eight different human G protein gamma subunits, including three novel forms designated the gamma 4, gamma 10, and gamma 11 subunits .
Author Ray,K., Kunsch,C., Bonner,L.M. and Robishaw,J.D.
Journal J. Biol. Chem. 270 (37), 21765-21771 (1995)
Title Structure of the bovine transducin gamma subunit gene and analysis of promoter function in transgenic mice .
Author Tao,L., Pandey,S., Simon,M.I. and Fong,H.K.
Journal Exp. Eye Res. 56 (4), 497-507 (1993)
Title G-protein beta gamma dimers. Membrane targeting requires subunit coexpression and intact gamma C-A-A-X domain .
Author Simonds,W.F., Butrynski,J.E., Gautam,N., Unson,C.G. and Spiegel,A.M.
Journal J. Biol. Chem. 266 (9), 5363-5366 (1991)
Title Isolation and characterization of a cDNA clone for the gamma subunit of bovine retinal transducin .
Author Hurley,J.B., Fong,H.K., Teplow,D.B., Dreyer,W.J. and Simon,M.I.
Journal Proc. Natl. Acad. Sci. U.S.A. 81 (22), 6948-6952 (1984)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878