• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cadherin-related 23 (CDH23), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu22446 Homo sapiens cadherin-related 23 (CDH23), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand TBD TBD
OHu22446C Homo sapiens cadherin-related 23 (CDH23), transcript variant 1, mRNA. Customized vector On-demand TBD TBD

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_022124.5, 284925125
Length 10065 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens cadherin-related 23 (CDH23), transcript variant 1, mRNA.
Product cadherin-23 isoform 1 precursor
Comment

Summary: This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is thought to be involved in stereocilia organization and hair bundle formation. The gene is located in a region containing the human deafness loci DFNB12 and USH1D. Usher syndrome 1D and nonsyndromic autosomal recessive deafness DFNB12 are caused by allelic mutations of this cadherin-like gene. Upregulation of this gene may also be associated with breast cancer. Alternative splice variants encoding different isoforms have been described. [provided by RefSeq, May 2013].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1).

RefSeq NP_071407.4
CDS 391..10455
Misc Feature(1)100..102
Misc Feature(2)100..102
Misc Feature(3)514..774
Misc Feature(4)order(520..525,670..672,676..678,760..762,766..771)
Misc Feature(5)796..1083
Misc Feature(6)order(817..822,970..972,976..978,1072..1074,1078..1083)
Misc Feature(7)1108..1422
Misc Feature(8)order(1129..1134,1288..1290,1294..1296,1408..1410,
Misc Feature(9)1444..1758
Misc Feature(10)order(1465..1470,1648..1650,1654..1656,1744..1746,
Misc Feature(11)1783..2061
Misc Feature(12)order(1801..1806,1954..1956,1960..1962,2047..2049,
Misc Feature(13)2086..2391
Misc Feature(14)order(2104..2109,2272..2274,2278..2280,2377..2379,
Misc Feature(15)2416..2712
Misc Feature(16)order(2434..2439,2593..2595,2599..2601,2698..2700,
Misc Feature(17)2734..3048
Misc Feature(18)order(2755..2760,2911..2913,2917..2919,3034..3036,
Misc Feature(19)3070..3360
Misc Feature(20)order(3091..3096,3250..3252,3256..3258,3349..3351,
Misc Feature(21)3385..3684
Misc Feature(22)order(3406..3411,3565..3567,3571..3573,3670..3672,
Misc Feature(23)3706..3999
Misc Feature(24)order(3727..3732,3889..3891,3895..3897,3988..3990,
Misc Feature(25)4042..4314
Misc Feature(26)order(4048..4053,4204..4206,4210..4212,4303..4305,
Misc Feature(27)4339..4632
Misc Feature(28)order(4360..4365,4522..4524,4528..4530,4618..4620,
Misc Feature(29)4666..4959
Misc Feature(30)order(4678..4683,4846..4848,4852..4854,4945..4947,
Misc Feature(31)4987..5280
Misc Feature(32)order(5005..5010,5167..5169,5173..5175,5266..5268,
Misc Feature(33)5302..5610
Misc Feature(34)order(5323..5328,5485..5487,5491..5493,5596..5598,
Misc Feature(35)5644..5931
Misc Feature(36)order(5656..5661,5818..5820,5824..5826,5917..5919,
Misc Feature(37)5953..6255
Misc Feature(38)order(5974..5979,6133..6135,6139..6141,6241..6243,
Misc Feature(39)6277..6585
Misc Feature(40)order(6298..6303,6472..6474,6478..6480,6571..6573,
Misc Feature(41)6613..6897
Misc Feature(42)order(6628..6633,6787..6789,6793..6795,6886..6888,
Misc Feature(43)6928..7257
Misc Feature(44)order(6943..6948,7129..7131,7135..7137,7243..7245,
Misc Feature(45)7291..7584
Misc Feature(46)order(7309..7314,7471..7473,7477..7479,7570..7572,
Misc Feature(47)7606..7902
Misc Feature(48)order(7627..7632,7780..7782,7786..7788,7891..7893,
Misc Feature(49)7927..8211
Misc Feature(50)order(7948..7953,8104..8106,8197..8199,8203..8208)
Misc Feature(51)8248..8544
Misc Feature(52)order(8260..8265,8428..8430,8434..8436,8530..8532,
Misc Feature(53)8593..8913
Misc Feature(54)order(8605..8610,8764..8766,8770..8772,8902..8904,
Misc Feature(55)8938..9243
Misc Feature(56)order(8959..8964,9151..9153,9157..9159)
Misc Feature(57)9583..9645
Exon (1)1..385
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (2)386..457
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (3)458..535
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (4)536..678
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (5)679..726
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (6)727..819
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (7)820..1014
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (8)1015..1143
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (9)1144..1222
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (10)1223..1335
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (11)1336..1524
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (12)1525..1530
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (13)1531..1680
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (14)1681..1839
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (15)1840..1904
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (16)1905..2142
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (17)2143..2248
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (18)2249..2376
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (19)2377..2449
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (20)2450..2566
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (21)2567..2679
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (22)2680..2787
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (23)2788..2977
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (24)2978..3123
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (25)3124..3343
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (26)3344..3496
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (27)3497..3610
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (28)3611..3759
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (29)3760..3820
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (30)3821..3969
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (31)3970..4105
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (32)4106..4494
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (33)4495..4596
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (34)4597..4599
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (35)4600..4749
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (36)4750..4878
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (37)4879..5007
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (38)5008..5235
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (39)5236..5457
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (40)5458..5577
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (41)5578..5758
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (42)5759..5892
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (43)5893..6102
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (44)6103..6210
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (45)6211..6313
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (46)6314..6439
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (47)6440..6643
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (48)6644..7102
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (49)7103..7219
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (50)7220..7444
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (51)7445..7614
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (52)7615..7752
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (53)7753..7872
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (54)7873..8050
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (55)8051..8262
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (56)8263..8454
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (57)8455..8568
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (58)8569..8698
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (59)8699..8950
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (60)8951..9112
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (61)9113..9369
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (62)9370..9467
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (63)9468..9588
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (64)9589..9668
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (65)9669..9709
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (66)9710..9770
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (67)9771..9900
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (68)9901..10023
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (69)10024..10128
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Exon (70)10129..11124
Gene:CDH23
Gene Synonym:CDHR23; USH1D
Translation MGRHVATSCHVAWLLVLISGCWGQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLAQDM DNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNI QVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSQFFAI DSARGIVTVIRELDYETTQAYQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLP YSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGVLTLNGLLD RENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITEL AQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLD YETVDRYDFDLFANESVPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVL TVLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTIIARDGGG EETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNQITYSI VSASAFGSYFDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIE VFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEGSTQFR INARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKD APYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAML DRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVL EGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGVVVTTTELDRERIAE YQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCT DNDVGLNAELSYFITGGNVDGKFSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNGPVGK RHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSILQLKATDADEGEFGRVWYR ILHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAYNHDLGPMRSSVRVIVYVED INDEAPVFTQQQYSRLGLRETAGIGTSVIVVQATDRDSGDGGLVNYRILSGAEGKFEIDE STGLIITVNYLDYETKTSYMMNVSATDQAPPFNQGFCSVYITLLNELDEAVQFSNASYEA AILENLALGTEIVRVQAYSIDNLNQITYRFNAYTSTQAKALFKIDAITGVITVQGLVDRE KGDFYTLTVVADDGGPKVDSTVKVYITVLDENDNSPRFDFTSDSAVSIPEDCPVGQRVAT VKAWDPDAGSNGQVVFSLASGNIAGAFEIVTTNDSIGEVFVARPLDREELDHYILQVVAS DRGTPPRKKDHILQVTILDINDNPPVIESPFGYNVSVNENVGGGTAVVQVRATDRDIGIN SVLSYYITEGNKDMAFRMDRISGEIATRPAPPDRERQSFYHLVATVEDEGTPTLSATTHV YVTIVDENDNAPMFQQPHYEVLLDEGPDTLNTSLITIQALDLDEGPNGTVTYAIVAGNIV NTFRIDRHMGVITAAKELDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDN VPTFPRDYEGPFEVTEGQPGPRVWTFLAHDRDSGPNGQVEYSIMDGDPLGEFVISPVEGV LRVRKDVELDRETIAFYNLTICARDRGMPPLSSTMLVGIRVLDINDNDPVLLNLPMNITI SENSPVSSFVAHVLASDADSGCNARLTFNITAGNRERAFFINATTGIVTVNRPLDRERIP EYKLTISVKDNPENPRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGTPLTV LNGPILALDADQDIYAVVTYQLLGAQSGLFDINSSTGVVTVRSGVIIDREAFSPPILELL LLAEDIGLLNSTAHLLITILDDNDNRPTFSPATLTVHLLENCPPGFSVLQVTATDEDSGL NGELVYRIEAGAQDRFLIHLVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIV TILIDDINDSRPEFLNPIQTVSVLESAEPGTVIANITAIDHDLNPKLEYHIVGIVAKDDT DRLVPNQEDAFAVNINTGSVMVKSPMNRELVATYEVTLSVIDNASDLPERSVSVPNAKLT VNVLDVNDNTPQFKPFGITYYMERILEGATPGTTLIAVAAVDPDKGLNGLVTYTLLDLVP PGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNP IFDQPSYQEAVFEDVPVGTIILTVTATDADSGNFALIEYSLGDGESKFAINPTTGDIYVL SSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFSTSVYE NEPAGTSVITMMATDQDEGPNGELTYSLEGPGVEAFHVDMDSGLVTTQRPLQSYEKFSLT VVATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIREEIPLRSNVYEVYATDK DEGLNGAVRYSFLKTAGNRDWEFFIIDPISGLIQTAQRLDRESQAVYSLILVASDLGQPV PYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGP NAIVYYFIAAGNEEKNFHLQPDGCLLVLRDLDREREAIFSFIVKASSNRSWTPPRGPSPT LDLVADLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGNNSL VFYSILAIHYFRALANDSEDVGQVFTMGSMDGILRTFDLFMAYSPGYFVVDIVARDLAGH NDTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIHLLSNITGAIVNTDNVQFHVDKKG RVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAISVRLPD DMSALQMAIIVLAILLFLAAMLFVLMNWYYRTVHKRKLKAIVAGSAGNRGFIDIMDMPNT NKYSFDGANPVWLDPFCRNLELAAQAEHEDDLPENLSEIADLWNSPTRTHGTFGREPAAV KPDDDRYLRAAIQEYDNIAKLGQIIREGPIKGSLLKVVLEDYLRLKKLFAQRMVQKASSC HSSISELIQTELDEEPGDHSPGQGSLRFRHKPPVELKGPDGIHVVHGSTGTLLATDLNSL PEEDQKGLGRSLETLTAAEATAFERNARTESAKSTPLHKLRDVIMETPLEITEL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
133+a, gdbSNP:139742443
311+c, tdbSNP:111396715
343..344+, cgaggdbSNP:147915565
344..348+, cgaggdbSNP:377387074
360..361+, aggcgdbSNP:71012280
361+a, cdbSNP:113278321
390+dbSNP:
390+c, tdbSNP:41281302
397+c, tdbSNP:7902757
398+a, gdbSNP:397517363
432+c, tdbSNP:371440350
436+, gdbSNP:397517331
469+dbSNP:
469+c, tdbSNP:370760723
517+a, gdbSNP:375566405
519+c, tdbSNP:201925753
563+dbSNP:
563+a, gdbSNP:61732490
588+a, gdbSNP:111033288
594+c, tdbSNP:116624130
611+a, cdbSNP:114135543
617+g, tdbSNP:373802615
646+a, gdbSNP:200085829
659+a, gdbSNP:397517317
684+dbSNP:
684+a, gdbSNP:368628451
701+a, gdbSNP:372335230
714+c, tdbSNP:373668614
715+a, gdbSNP:199793172
720+c, tdbSNP:201232514
complement(756)-dbSNP:
complement(756)-g, adbSNP:3802720
775+a, gdbSNP:200328570
776+c, tdbSNP:183046743
777+a, gdbSNP:201919232
809+a, gdbSNP:201361229
813+c, tdbSNP:267602567
835+dbSNP:
835+a, tdbSNP:376285214
836+c, tdbSNP:370947344
850+a, gdbSNP:199741966
899+c, gdbSNP:200835414
900+c, tdbSNP:143341423
921+c, tdbSNP:371933124
925+a, gdbSNP:371422466
929+c, tdbSNP:374531277
936+c, tdbSNP:368040543
941+a, gdbSNP:201132251
943+a, gdbSNP:375465342
949+a, gdbSNP:369624952
962+g, tdbSNP:372588663
964+c, gdbSNP:199514829
1002+a, gdbSNP:200200488
1008+c, tdbSNP:397517348
1109+dbSNP:
1109+c, tdbSNP:121908354
1157+dbSNP:
1157+a, gdbSNP:371646164
1162+a, gdbSNP:370782827
1168+g, tdbSNP:373294595
1215+c, tdbSNP:376436182
1260+dbSNP:
1260+c, tdbSNP:375292899
1284+a, gdbSNP:111033474
1291+c, tdbSNP:397517364
1292+a, gdbSNP:121908355
1299+c, tdbSNP:201884566
1329+c, tdbSNP:377145705
1353+dbSNP:
1353+c, tdbSNP:374959661
1358+a, gdbSNP:181449189
1365+a, tdbSNP:373112792
1372+a, gdbSNP:374545987
1385+c, tdbSNP:376301184
1387+a, tdbSNP:371005464
1401+g, tdbSNP:201783407
1422+c, tdbSNP:369307086
1425+c, tdbSNP:45581037
1428+a, gdbSNP:74608315
1443+c, tdbSNP:7903475
1451+a, gdbSNP:200792189
1453+a, gdbSNP:374571664
1458+c, tdbSNP:141247813
1468+c, tdbSNP:185917383
1486+a, gdbSNP:143282422
1558+dbSNP:
1558+c, tdbSNP:369803887
1572+c, tdbSNP:192730794
1575+c, tdbSNP:185105210
1585+a, tdbSNP:377492133
1588+a, tdbSNP:370014467
1595+c, tdbSNP:373168635
1596+a, gdbSNP:397517304
1602+c, tdbSNP:377441168
1603+a, gdbSNP:370549448
1608+a, gdbSNP:375312983
1615+a, gdbSNP:376657497
1617+a, gdbSNP:371212430
1624+c, tdbSNP:374419277
1625+a, gdbSNP:368817860
1636..1656+, gccatcccactggactacgagdbSNP:397517305
1659+c, tdbSNP:372340806
1660+a, gdbSNP:2305207
1666+c, tdbSNP:373674747
1672+a, gdbSNP:188376296
1691+dbSNP:
1691+a, gdbSNP:139287714
1697+a, gdbSNP:111033369
1728+a, gdbSNP:201686574
1736+c, tdbSNP:200997507
1745+a, gdbSNP:375646885
1787+a, cdbSNP:369846470
1813+a, gdbSNP:62622410
1813+a, gdbSNP:386454151
1818+g, tdbSNP:397517306
1836+a, cdbSNP:200324241
1839+c, gdbSNP:368830397
1859+dbSNP:
1859+c, gdbSNP:1227049
1862+c, tdbSNP:397517307
1868+a, gdbSNP:397517308
1877+a, gdbSNP:10999947
1894+a, gdbSNP:200459094
1905+dbSNP:
1905+a, gdbSNP:372936335
1910+c, tdbSNP:201584731
1925+c, tdbSNP:370747698
1926+a, gdbSNP:56128491
1974+c, tdbSNP:397517309
1985+c, tdbSNP:201297042
1986+g, tdbSNP:148361187
1997+a, gdbSNP:376414013
2008+a, gdbSNP:371116044
2010+c, tdbSNP:374231594
2027+a, gdbSNP:199508694
2039+a, gdbSNP:79464349
2040+c, tdbSNP:370626803
2055+c, tdbSNP:397517310
2056+a, gdbSNP:374014052
2061+c, tdbSNP:368162217
2075+a, gdbSNP:397517311
2085+c, gdbSNP:372380590
2088+c, tdbSNP:373296547
2089+a, gdbSNP:377148854
2110+a, gdbSNP:368496789
2135+a, gdbSNP:200263980
2140+c, tdbSNP:375781856
2148+dbSNP:
2148+a, gdbSNP:371419130
2150+a, gdbSNP:373467174
2193+c, gdbSNP:201024982
2204+c, tdbSNP:201475055
2221+a, gdbSNP:374527066
2256+dbSNP:
2256+c, tdbSNP:397517312
2257+a, gdbSNP:143782870
2263+c, tdbSNP:374592204
2264+a, gdbSNP:200907423
2309+c, tdbSNP:199796910
2352+c, gdbSNP:371365429
2353+a, gdbSNP:374805957
2371+a, gdbSNP:369157174
2402+dbSNP:
2402+, tdbSNP:397517313
2412+c, tdbSNP:377445540
2413+a, gdbSNP:376039927
2456+dbSNP:
2456+c, tdbSNP:368603023
2476+a, gdbSNP:372874226
2481+c, tdbSNP:373649363
2518+a, gdbSNP:367750869
2539+a, gdbSNP:397517314
2553+c, tdbSNP:192326086
2561+a, gdbSNP:374955091
2567+dbSNP:
2567+a, gdbSNP:369836147
2582+c, tdbSNP:374560242
2583+c, gdbSNP:397517315
2597+a, gdbSNP:377348311
2625+c, tdbSNP:368841307
2629+c, tdbSNP:200649500
2640..2641+, gdbSNP:34432586
2641+a, gdbSNP:41281306
2653+c, tdbSNP:181255269
2658+c, tdbSNP:373077743
2673+c, tdbSNP:267602568
2701+dbSNP:
2701+a, gdbSNP:375474793
complement(2706)-g, adbSNP:3752752
2717+c, tdbSNP:372607534
2720+a, c, tdbSNP:199709482
2721+a, gdbSNP:367797304
2727+a, gdbSNP:111033461
2731+a, gdbSNP:375918283
2732+c, tdbSNP:369203863
2735+c, gdbSNP:373391900
2758+a, gdbSNP:187827251
complement(2778)-g, adbSNP:3752751
2784+c, tdbSNP:373269394
2808+dbSNP:
2808+a, cdbSNP:374806474
2814+a, gdbSNP:76601590
2832+a, gdbSNP:374387579
2890+c, tdbSNP:372387390
2892+c, tdbSNP:55918133
2901+c, tdbSNP:377130089
2914+c, gdbSNP:368496658
2926+a, gdbSNP:372807578
2943+a, gdbSNP:374847452
2946+a, gdbSNP:61852054
2958+c, gdbSNP:188498736
2962+a, gdbSNP:181275139
2965+c, tdbSNP:376092633
2986+dbSNP:
2986+, cdbSNP:34768093
3085+a, gdbSNP:370773983
3101+c, tdbSNP:199894395
3104+c, tdbSNP:201871422
3121+c, gdbSNP:368336823
3135+dbSNP:
3135+c, tdbSNP:183220886
3141+c, gdbSNP:369180032
3156+c, tdbSNP:371670151
3171+c, tdbSNP:375102725
3180+a, gdbSNP:111033528
3184+a, gdbSNP:373305209
3205+c, gdbSNP:200553795
3220+a, gdbSNP:188098974
3225+c, tdbSNP:373035321
3230+a, tdbSNP:397517318
3236+c, tdbSNP:377425731
3244+a, gdbSNP:370554545
3255+c, tdbSNP:79636933
3265+a, gdbSNP:200196800
3268+a, gdbSNP:111033458
3281+a, gdbSNP:376560330
3299+c, tdbSNP:202203105
3315+a, gdbSNP:368762730
3316+a, gdbSNP:372401651
3330+a, gdbSNP:373631099
3341+a, gdbSNP:371477759
3343+c, gdbSNP:374964318
3348+dbSNP:
3348+a, gdbSNP:74702249
3352+a, gdbSNP:370586099
3360+c, tdbSNP:56216952
3381+a, gdbSNP:376773015
3399+c, tdbSNP:10823829
3400+a, gdbSNP:79705488
3412+a, gdbSNP:201053044
3419+a, gdbSNP:370107953
3460+a, gdbSNP:397517319
3464+a, gdbSNP:143179070
3482+c, gdbSNP:397517320
3508+dbSNP:
3508+g, tdbSNP:200177873
3523+g, tdbSNP:377100683
3532+c, tdbSNP:181843079
3534+c, tdbSNP:372927470
3552+c, gdbSNP:377259987
3555+a, gdbSNP:370826064
3568+c, tdbSNP:201536811
3576+a, cdbSNP:201589645
3596+g, tdbSNP:74390113
3603+a, gdbSNP:140255091
3603+a, gdbSNP:386475019
3615..3616+dbSNP:
3615..3616+, gdbSNP:35865328
3620+c, tdbSNP:202101019
3638..3639+, gdbSNP:34236496
3639+a, gdbSNP:79805606
3644+c, tdbSNP:368147248
3652+a, gdbSNP:200632520
3656+g, tdbSNP:372378807
3657+c, tdbSNP:377126049
3658+a, gdbSNP:368487578
3683+a, gdbSNP:41281310
3685..3686+, gdbSNP:34242194
3688+a, cdbSNP:377676159
3691+a, gdbSNP:199510686
3695+a, tdbSNP:369002480
3697+c, tdbSNP:113714164
3720+c, tdbSNP:371962929
3721+a, gdbSNP:397517321
3727+c, gdbSNP:397517322
3751+a, tdbSNP:200542052
3754+g, tdbSNP:77821631
3786+dbSNP:
3786+c, tdbSNP:370172637
3787+a, gdbSNP:111033509
3842+dbSNP:
3842+a, gdbSNP:370944611
3857+a, gdbSNP:375367387
3870+g, tdbSNP:111033519
3871+c, tdbSNP:397517323
3876+g, tdbSNP:397517324
3883+c, tdbSNP:373622821
3898+c, tdbSNP:199866703
3940+a, gdbSNP:397517325
3964+a, gdbSNP:80028391
4009+dbSNP:
4009+a, gdbSNP:111033488
4015+a, gdbSNP:41281314
4018+c, tdbSNP:397517326
4023+g, tdbSNP:368825395
4034+a, gdbSNP:373422805
4054+a, gdbSNP:41281316
4071+a, cdbSNP:370848345
4074+c, tdbSNP:373091912
4078+g, tdbSNP:377358096
4096+c, tdbSNP:397517327
4097+a, gdbSNP:186990940
4129+dbSNP:
4129+c, tdbSNP:202204597
4148..4149+, gdbSNP:33998064
4154+a, tdbSNP:372158876
4166+a, tdbSNP:373300630
4191+c, tdbSNP:56107171
4192+a, gdbSNP:201884261
4235+a, gdbSNP:149073355
4242+a, gdbSNP:372172457
4259+c, tdbSNP:377222292
4270+c, tdbSNP:121908350
4284+c, tdbSNP:370094327
4285+a, gdbSNP:201610096
4311+a, gdbSNP:376660937
4315+a, gdbSNP:111033468
4317+a, gdbSNP:115398922
4344+c, tdbSNP:373366898
4373+c, tdbSNP:370383552
4376+a, gdbSNP:201877610
4389+a, gdbSNP:111033453
4390+c, tdbSNP:373276722
4391+a, gdbSNP:199953929
4408+a, gdbSNP:376392673
4411+a, gdbSNP:121908351
4430+c, tdbSNP:371125497
4431+a, gdbSNP:373634236
4434+c, tdbSNP:367771516
4435+c, tdbSNP:41281318
complement(4441)-t, cdbSNP:1227065
4441+a, gdbSNP:386523539
4458+c, gdbSNP:143136329
4470+c, tdbSNP:372430411
4485+c, tdbSNP:368582818
4506+dbSNP:
4506+a, gdbSNP:369188108
4530+a, gdbSNP:371538838
4531+a, gdbSNP:368064278
4536+c, tdbSNP:201008425
4593+c, tdbSNP:202166096
4606+dbSNP:
4606+a, gdbSNP:192459984
4621+a, gdbSNP:375057273
4640+a, gdbSNP:369353175
4646+a, cdbSNP:371698747
4662+a, gdbSNP:375062178
4665+a, gdbSNP:369559033
4674+a, gdbSNP:373247422
4677+c, tdbSNP:377493327
4678+a, gdbSNP:373020999
4689+a, tdbSNP:12218559
4699+c, tdbSNP:397517329
4700+a, gdbSNP:56181447
4731+c, tdbSNP:12218564
4781+dbSNP:
4781+c, tdbSNP:374362883
4795+a, gdbSNP:200635365
4803+c, tdbSNP:199700008
4822+a, gdbSNP:368798550
4841+c, tdbSNP:371145622
4878+c, gdbSNP:121908347
4888+dbSNP:
4888+a, tdbSNP:375641853
4899+c, tdbSNP:10999978
4910+a, gdbSNP:373480195
4924+a, tdbSNP:375704804
4926+a, cdbSNP:191759543
4945+c, gdbSNP:397517330
4947+c, tdbSNP:368781664
4972+a, gdbSNP:201533282
5010+dbSNP:
5010+a, c, tdbSNP:111033490
5027+c, tdbSNP:145316633
5061+c, tdbSNP:182260167
5083+c, tdbSNP:371371892
5094+c, tdbSNP:186866326
complement(5113)-t, cdbSNP:1227051
5136+c, tdbSNP:370132610
5152+c, tdbSNP:137937502
5153+a, gdbSNP:367978947
5154+g, tdbSNP:371742345
5163+a, gdbSNP:376037961
5170+c, tdbSNP:200664666
5171+a, gdbSNP:368368136
5176+c, tdbSNP:372636295
5196+c, gdbSNP:377237148
5222+c, tdbSNP:370034021
5232+c, gdbSNP:368377560
5243+dbSNP:
5243+c, tdbSNP:371884850
5244+a, gdbSNP:376538879
5247+c, tdbSNP:369817589
5248+a, gdbSNP:41281330
5253+c, tdbSNP:374797859
5254+a, gdbSNP:199754104
5256+a, gdbSNP:368777167
5265+a, gdbSNP:149664909
5280+c, tdbSNP:377519065
5282+c, tdbSNP:370762269
5337+a, gdbSNP:373046094
5343+c, tdbSNP:397517332
5352+c, tdbSNP:377372797
5399+a, tdbSNP:397517333
5412+c, tdbSNP:376952695
5413+a, gdbSNP:17712523
5416+a, gdbSNP:56043301
5428+a, gdbSNP:201364852
5436+c, tdbSNP:370618924
5440+c, tdbSNP:111033522
5441+c, gdbSNP:111033475
5443+a, cdbSNP:368570272
5445+c, tdbSNP:377269771
5446+a, gdbSNP:373836924
5456+c, tdbSNP:397517334
5473+dbSNP:
5473+g, tdbSNP:372120939
5481+a, gdbSNP:376721494
5490+c, tdbSNP:10762480
5503+a, gdbSNP:373164088
5507+a, gdbSNP:376614796
5515+c, tdbSNP:369100053
5520+a, c, tdbSNP:111033487
5521+a, gdbSNP:181611778
5523+c, tdbSNP:184576414
5536+a, cdbSNP:369740230
5551+c, tdbSNP:78119792
5558+a, gdbSNP:189361642
5577+a, gdbSNP:376386945
5590+dbSNP:
5590+a, gdbSNP:397517335
5605+a, gdbSNP:370337521
5609+a, tdbSNP:397517336
5610+c, tdbSNP:374711944
5611+a, gdbSNP:368206785
5618+a, cdbSNP:191021194
5626+c, tdbSNP:201763918
5627+a, gdbSNP:111033270
5633+a, gdbSNP:368440350
5638+a, gdbSNP:372822465
5662+c, tdbSNP:397517337
5687+c, tdbSNP:114745089
5702+a, gdbSNP:111033480
5718+c, tdbSNP:371522191
5725+c, gdbSNP:376114326
5743+a, gdbSNP:397517338
5778+dbSNP:
5778+c, tdbSNP:373547262
5800+c, tdbSNP:376271562
complement(5801)-t, cdbSNP:3802711
5808+c, gdbSNP:74145660
5809+a, gdbSNP:143993990
5821+c, tdbSNP:370391659
5832+c, tdbSNP:373768157
5833+a, gdbSNP:199581934
5844+c, tdbSNP:370547595
5861+a, gdbSNP:111033491
5871+g, tdbSNP:375545532
5889+c, tdbSNP:397517339
5892+a, gdbSNP:372785265
5895+dbSNP:
5895+a, gdbSNP:200786014
5908+c, tdbSNP:145951744
5909+a, gdbSNP:375083901
5913+a, gdbSNP:369513655
5931+c, tdbSNP:148632119
5932+a, gdbSNP:188078418
5934+c, tdbSNP:142131750
5966+c, tdbSNP:191676428
6043+c, tdbSNP:368848049
6050+c, tdbSNP:397517340
6053+c, tdbSNP:121908352
6057+c, tdbSNP:375358318
6065+c, tdbSNP:370004432
6073+c, tdbSNP:201490610
6101+c, tdbSNP:372981760
6102+a, gdbSNP:397517342
6112+dbSNP:
6112+a, gdbSNP:368828743
6124+c, tdbSNP:397517344
6125+a, gdbSNP:142663207
6143+a, gdbSNP:115113440
6178+g, tdbSNP:377599924
6186+a, gdbSNP:370965108
6196+c, tdbSNP:200895128
6202+a, gdbSNP:375765955
6221+dbSNP:
6221+c, tdbSNP:201876362
6259..6264+, cccctcdbSNP:397517345
6261+c, gdbSNP:368122233
6262+c, gdbSNP:371886908
6321+dbSNP:
6321+c, tdbSNP:373457993
6327+a, gdbSNP:397517347
6330+a, gdbSNP:377520599
6375+c, tdbSNP:370762205
6386+c, gdbSNP:11592462
6403+g, tdbSNP:376752550
6416+a, tdbSNP:201067092
6439+a, gdbSNP:183431253
6470+dbSNP:
6470+c, tdbSNP:185819621
6471+g, tdbSNP:114919561
6481+a, gdbSNP:368381520
6520+a, gdbSNP:10466026
6523+a, gdbSNP:121908348
6547+a, gdbSNP:375845975
6555+g, tdbSNP:370170982
6558+c, tdbSNP:371570295
6560+c, tdbSNP:186693562
6586+c, tdbSNP:111033489
6587+a, gdbSNP:201887949
6634+c, tdbSNP:369033806
6639+a, gdbSNP:55964031
6665+dbSNP:
6665+c, tdbSNP:145868749
6679+a, gdbSNP:373656370
6682+a, gdbSNP:375699270
6696+a, gdbSNP:370320029
6719+c, tdbSNP:111033492
6723+a, gdbSNP:368155422
6724+a, gdbSNP:371928601
6728+a, tdbSNP:182041993
6733+c, tdbSNP:375329233
6756+c, tdbSNP:368440578
6765+c, gdbSNP:16929354
6767+a, gdbSNP:201942629
6792..6795+, agagdbSNP:55947063
6802+, gdbSNP:111033473
6811+a, gdbSNP:376414352
6812+g, tdbSNP:368778687
6816+a, gdbSNP:371932558
6819+a, gdbSNP:142788731
6824+g, tdbSNP:200933929
6829+a, gdbSNP:369570187
6832+a, gdbSNP:111033271
6836+a, gdbSNP:377376107
6843+a, cdbSNP:369701382
6844+a, gdbSNP:369493909
6855+a, gdbSNP:373462599
6879+c, gdbSNP:111033493
6882+c, tdbSNP:41281332
6912+c, tdbSNP:374436837
6920+c, tdbSNP:376453794
6937+a, gdbSNP:370794439
6946+a, tdbSNP:374194433
6955+c, tdbSNP:368305683
6959+a, gdbSNP:371090961
6980+c, tdbSNP:372190847
6981+a, gdbSNP:376105044
6986+a, tdbSNP:111033494
6994+a, gdbSNP:121908349
7004+c, tdbSNP:397517349
7021+a, gdbSNP:371363040
7027+a, gdbSNP:375900265
7038+c, tdbSNP:186394654
7068+c, tdbSNP:372120764
7077+c, tdbSNP:76463072
7095+c, tdbSNP:114827737
7100+c, gdbSNP:373211167
7112..7113+dbSNP:
7112..7113+, gdbSNP:35428767
7199+a, gdbSNP:139409005
7237+dbSNP:
7237+a, gdbSNP:41281334
7242+c, gdbSNP:56013867
7259+c, tdbSNP:370912192
7301+a, gdbSNP:201434373
7308+a, gdbSNP:146819206
7322+c, gdbSNP:368449271
7358+, cdbSNP:397517350
7380+g, tdbSNP:111033495
7393+c, tdbSNP:367737183
7439+c, tdbSNP:371522435
7463+dbSNP:
7463+a, gdbSNP:4747194
7467+a, cdbSNP:191154178
7516+a, gdbSNP:9663920
7521+c, tdbSNP:369805384
7522+a, gdbSNP:181197242
7529+c, tdbSNP:4747195
7566+c, tdbSNP:375991880
7573+a, cdbSNP:369150664
7599+a, cdbSNP:373372629
7674+dbSNP:
7674+c, tdbSNP:371416681
7685+a, gdbSNP:201579860
7752+a, gdbSNP:370983472
7772+dbSNP:
7772+c, gdbSNP:373823262
7784+a, gdbSNP:199903227
7811+c, tdbSNP:371693299
7832+c, gdbSNP:397517351
7833..7834+, gdbSNP:34911784
7845+c, tdbSNP:374142128
7853+a, gdbSNP:148149598
7856+a, gdbSNP:141986620
7857+c, tdbSNP:111033289
7858+a, gdbSNP:41281336
7861+a, gdbSNP:368141143
7891+dbSNP:
7891+a, gdbSNP:397517352
7894+a, gdbSNP:373816780
7942+a, gdbSNP:376617494
7958+c, tdbSNP:369761606
7962+a, gdbSNP:10823849
7972+a, gdbSNP:377468901
8003+a, gdbSNP:371064571
8005+c, gdbSNP:373649718
8020+c, tdbSNP:114819374
8047+a, gdbSNP:370325211
8049+a, gdbSNP:113730381
8056+dbSNP:
8056+c, tdbSNP:374322139
8069+g, tdbSNP:368749897
8112+c, tdbSNP:111033483
8136+g, tdbSNP:371192973
8152+c, gdbSNP:41281338
8159+c, tdbSNP:368781470
8166+a, gdbSNP:397517353
8212+c, tdbSNP:370922401
8213+a, gdbSNP:202052174
8239+c, gdbSNP:369379727
8271+dbSNP:
8271+a, gdbSNP:370083132
8277+c, tdbSNP:182647000
8281+a, cdbSNP:372692810
8283+c, tdbSNP:377121007
8311+c, gdbSNP:397517354
8338+c, tdbSNP:370572756
8384+c, tdbSNP:375019257
8386+a, gdbSNP:368394419
8389+c, gdbSNP:200251748
8394+a, gdbSNP:376111586
8412+a, gdbSNP:201733315
8447+c, tdbSNP:371567666
8473+dbSNP:
8473+a, gdbSNP:369501114
8501+c, gdbSNP:373214645
8510+c, tdbSNP:373230009
8511+g, tdbSNP:377535432
8557+c, gdbSNP:142857685
8619+dbSNP:
8619+c, tdbSNP:372996083
8620+a, gdbSNP:376189742
8629+a, gdbSNP:370616165
8646+c, tdbSNP:372846962
8647+a, gdbSNP:397517356
8670+c, tdbSNP:377606585
8673+c, gdbSNP:397517357
8689+g, tdbSNP:370903798
8701+dbSNP:
8701+a, gdbSNP:201076440
8706+c, tdbSNP:368145346
8734+a, gdbSNP:202147495
8755+c, tdbSNP:375212593
8779+a, gdbSNP:140949515
8780+c, tdbSNP:370532702
complement(8791)-c, adbSNP:3802707
8797+a, gdbSNP:369697366
8801+a, gdbSNP:137853912
8834+a, gdbSNP:376835293
8843+c, tdbSNP:368998415
8855+a, gdbSNP:373155603
8889+c, tdbSNP:397517358
8890+a, gdbSNP:190672679
8924+a, gdbSNP:199668532
8955+dbSNP:
8955+a, gdbSNP:374059763
8958+c, tdbSNP:377647993
8973+a, gdbSNP:371383735
9027+c, tdbSNP:374552961
9040..9057+, agcattctggccatccacdbSNP:397517359
9048+a, gdbSNP:377572414
9114+dbSNP:
9114+a, gdbSNP:371638610
9116+a, gdbSNP:397517361
9119+c, tdbSNP:374171450
9127+a, tdbSNP:368317741
9133+c, tdbSNP:185818081
9134+a, gdbSNP:58875306
9155+c, tdbSNP:372613108
9171+a, cdbSNP:397517362
9198+c, tdbSNP:148743086
9213+c, tdbSNP:370184182
9214+a, gdbSNP:371286324
9218+c, tdbSNP:376632111
9219+a, gdbSNP:369023265
9229+a, gdbSNP:373806912
9246+a, gdbSNP:377598904
9249+c, tdbSNP:11000008
9259+a, gdbSNP:369587122
9267+c, gdbSNP:373709237
9276+c, tdbSNP:376881824
9285+c, tdbSNP:11000009
9289+c, tdbSNP:373602652
9290+a, gdbSNP:373600041
9291+c, tdbSNP:375720093
9297+c, tdbSNP:11000010
9334+a, gdbSNP:374012269
9344+a, cdbSNP:113125338
9356+a, cdbSNP:368110124
9391+dbSNP:
9391+a, cdbSNP:373064483
9392+a, gdbSNP:111033467
9404+c, gdbSNP:188966938
9405+a, gdbSNP:376497158
9427+a, gdbSNP:369776863
9436+c, tdbSNP:373416519
9439+a, gdbSNP:376545866
9448+c, tdbSNP:181658753
9460+a, gdbSNP:370087572
9467+a, gdbSNP:372632103
9476+dbSNP:
9476+a, cdbSNP:397517365
9477+a, gdbSNP:376098894
9484+a, gdbSNP:368603948
9486+c, tdbSNP:371570471
9517+c, tdbSNP:375907609
9538+c, gdbSNP:367912333
9560+a, gdbSNP:372141384
9567+a, gdbSNP:371609236
9593+dbSNP:
9593+c, tdbSNP:372434845
9594+a, gdbSNP:192266658
9628+a, gdbSNP:369395479
9680+dbSNP:
9680+a, cdbSNP:375796570
9681+g, tdbSNP:368441850
9701+c, gdbSNP:376432892
9716+dbSNP:
9716+a, gdbSNP:200188029
9725+c, tdbSNP:201359237
9729+c, tdbSNP:201812147
9763+c, tdbSNP:45583140
9789+dbSNP:
9789+a, gdbSNP:59687895
9803+a, gdbSNP:372676235
9809+a, tdbSNP:371829335
9822+c, tdbSNP:377150991
9828+a, gdbSNP:200572025
9882+c, tdbSNP:111990148
9891+a, gdbSNP:144906721
9892+c, tdbSNP:377655014
9914+dbSNP:
9914+a, gdbSNP:140884994
9955+c, tdbSNP:121908353
9959+c, tdbSNP:111033536
9996+a, cdbSNP:193244823
10007+a, gdbSNP:374156784
10019..10022+, tcaadbSNP:397517367
10019+c, tdbSNP:144688588
10060+dbSNP:
10060+c, tdbSNP:111033457
10105+c, tdbSNP:199848649
10140+dbSNP:
10140+c, tdbSNP:373708815
10148+a, cdbSNP:140463385
10150+a, gdbSNP:369713078
10161+a, cdbSNP:373249121
10189+c, tdbSNP:201727938
10245+a, gdbSNP:371170730
10249+a, gdbSNP:374102885
10255+a, gdbSNP:375712395
10260+a, cdbSNP:370265254
10263+a, gdbSNP:2290021
10274+c, gdbSNP:368112637
10276+a, gdbSNP:372388344
10293+c, tdbSNP:55717455
10294+a, gdbSNP:368743687
10311+, cdbSNP:34635910
10311+c, tdbSNP:144573209
10318+c, tdbSNP:200124827
10319+a, gdbSNP:377304591
10323+a, gdbSNP:367684899
10325+a, tdbSNP:371764852
10332+a, gdbSNP:376804660
10339+a, gdbSNP:187297872
10368+c, tdbSNP:73277900
10369+a, gdbSNP:200733236
10373+a, gdbSNP:148475933
10384+a, gdbSNP:373401356
10408+c, tdbSNP:376537401
10411+c, tdbSNP:370074117
10414+a, gdbSNP:372619247
10416+c, tdbSNP:377118941
10423+a, cdbSNP:368597074
10434+c, gdbSNP:370568585
10457+c, tdbSNP:373231756
10479+a, gdbSNP:375005162
10499+a, gdbSNP:142724265
10535+a, gdbSNP:75715348
10537+c, tdbSNP:189573932
10559+c, gdbSNP:377312107
10628+c, tdbSNP:143222936
10659+a, gdbSNP:2290022
complement(10666)-g, cdbSNP:146698236
10715+a, gdbSNP:180871119
10804+a, gdbSNP:1867978
10816+a, cdbSNP:115033851
10820+c, gdbSNP:371878149
10863+a, gdbSNP:376837903
10894+c, tdbSNP:140312023
10952+a, gdbSNP:150035625
10965+a, gdbSNP:1054635
10970+a, cdbSNP:16929375
10989+c, gdbSNP:145367957
11001+c, tdbSNP:149214267
11041+, adbSNP:148667421
Gene SymbolCDH23
Gene SynonymCDHR23; USH1D
Chromosome10
Locus Map10q22.1
Title Massively parallel DNA sequencing facilitates diagnosis of patients with Usher syndrome type 1 .
Author Yoshimura H, Iwasaki S, Nishio SY, Kumakawa K, Tono T, Kobayashi Y, Sato H, Nagai K, Ishikawa K, Ikezono T, Naito Y, Fukushima K, Oshikawa C, Kimitsuki T, Nakanishi H and Usami S.
Journal PLoS ONE 9 (3), E90688 (2014)
Title Genetic analysis through OtoSeq of Pakistani families segregating prelingual hearing loss .
Author Shahzad M, Sivakumaran TA, Qaiser TA, Schultz JM, Hussain Z, Flanagan M, Bhinder MA, Kissell D, Greinwald JH Jr, Khan SN, Friedman TB, Zhang K, Riazuddin S, Riazuddin S and Ahmed ZM.
Journal Otolaryngol Head Neck Surg 149 (3), 478-487 (2013)
Title Structure of the N terminus of cadherin 23 reveals a new adhesion mechanism for a subset of cadherin superfamily members .
Author Elledge HM, Kazmierczak P, Clark P, Joseph JS, Kolatkar A, Kuhn P and Muller U.
Journal Proc. Natl. Acad. Sci. U.S.A. 107 (23), 10708-10712 (2010)
Title UMD-USHbases: a comprehensive set of databases to record and analyse pathogenic mutations and unclassified variants in seven Usher syndrome causing genes .
Author Baux D, Faugere V, Larrieu L, Le Guedard-Mereuze S, Hamroun D, Beroud C, Malcolm S, Claustres M and Roux AF.
Journal Hum. Mutat. 29 (8), E76-E87 (2008)
Title Spatiotemporal pattern and isoforms of cadherin 23 in wild type and waltzer mice during inner ear hair cell development .
Author Lagziel A, Ahmed ZM, Schultz JM, Morell RJ, Belyantseva IA and Friedman TB.
Journal Dev. Biol. 280 (2), 295-306 (2005)
Title Usher syndrome 1D and nonsyndromic autosomal recessive deafness DFNB12 are caused by allelic mutations of the novel cadherin-like gene CDH23 .
Author Bork JM, Peters LM, Riazuddin S, Bernstein SL, Ahmed ZM, Ness SL, Polomeno R, Ramesh A, Schloss M, Srisailpathy CR, Wayne S, Bellman S, Desmukh D, Ahmed Z, Khan SN, Kaloustian VM, Li XC, Lalwani A, Riazuddin S, Bitner-Glindzicz M, Nance WE, Liu XZ, Wistow G, Smith RJ, Griffith AJ, Wilcox ER, Friedman TB and Morell RJ.
Journal Am. J. Hum. Genet. 68 (1), 26-37 (2001)
Title Localization of the Usher syndrome type ID gene (Ush1D) to chromosome 10 .
Author Wayne S, Der Kaloustian VM, Schloss M, Polomeno R, Scott DA, Hejtmancik JF, Sheffield VC and Smith RJ.
Journal Hum. Mol. Genet. 5 (10), 1689-1692 (1996)
Title Mapping of DFNB12, a gene for a non-syndromal autosomal recessive deafness, to chromosome 10q21-22 .
Author Chaib H, Place C, Salem N, Dode C, Chardenoux S, Weissenbach J, el Zir E, Loiselet J and Petit C.
Journal Hum. Mol. Genet. 5 (7), 1061-1064 (1996)
Title Usher Syndrome Type I .
Author Keats,B.J.B. and Lentz,J.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Autosomal recessive nonsyndromal profound childhood deafness in a large pedigree. Audiometric features of the affected persons and the obligate carriers .
Author Marres HA and Cremers CW.
Journal Arch. Otolaryngol. Head Neck Surg. 115 (5), 591-595 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.