• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens nucleotide-binding oligomerization domain containing 2 (NOD2), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu27927 Homo sapiens nucleotide-binding oligomerization domain containing 2 (NOD2), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $1699.00 25
OHu27927C Homo sapiens nucleotide-binding oligomerization domain containing 2 (NOD2), transcript variant 1, mRNA. Customized vector On-demand $1699.00 25

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_022162.2, 649572334
Length 3123 bp
Structure linear
Update Date 10-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens nucleotide-binding oligomerization domain containing 2 (NOD2), transcript variant 1, mRNA.
Product nucleotide-binding oligomerization domain-containing protein 2 isoform 1
Comment

Summary: This gene is a member of the Nod1/Apaf-1 family and encodes a protein with two caspase recruitment (CARD) domains and six leucine-rich repeats (LRRs). The protein is primarily expressed in the peripheral blood leukocytes. It plays a role in the immune response to intracellular bacterial lipopolysaccharides (LPS) by recognizing the muramyl dipeptide (MDP) derived from them and activating the NFKB protein. Mutations in this gene have been associated with Crohn disease and Blau syndrome. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jun 2014].


Transcript Variant: This variant (1) encodes the longer isoform (1).

RefSeq NP_071445.1
CDS 106..3228
Misc Feature(1)94..96
Misc Feature(2)94..96
Misc Feature(3)205..462
Misc Feature(4)205..462
Misc Feature(5)292..336
Misc Feature(6)505..747
Misc Feature(7)982..1494
Misc Feature(8)2404..3201
Misc Feature(9)order(2404..2406,2410..2412,2419..2421,2425..2427,
Misc Feature(10)order(2413..2418,2575..2577,2743..2745,2827..2829,
Misc Feature(11)2476..2541
Misc Feature(12)<2488..3225
Misc Feature(13)2551..2622
Misc Feature(14)2635..2700
Misc Feature(15)2719..2757
Misc Feature(16)2803..2865
Misc Feature(17)2887..2952
Misc Feature(18)2971..3033
Misc Feature(19)3055..3120
Misc Feature(20)3139..3201
Translation MGEEGGSASHDEEERASVLLGHSPGCEMCSQEAFQAQRSQLVELLVSGSLEGFESVLDWL LSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLH GCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQR ARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEAATCKKYMAKLRTTVSAQSRFLSTY DGAETLCLEDIYTENVLEVWADVGMAGPPQKSPATLGLEELFSTPGHLNDDADTVLVVGE AGSGKSTLLQRLHLLWAAGQDFQEFLFVFPFSCRQLQCMAKPLSVRTLLFEHCCWPDVGQ EDIFQLLLDHPDRVLLTFDGFDEFKFRFTDRERHCSPTDPTSVQTLLFNLLQGNLLKNAR KVVTSRPAAVSAFLRKYIRTEFNLKGFSEQGIELYLRKRHHEPGVADRLIRLLQETSALH GLCHLPVFSWMVSKCHQELLLQEGGSPKTTTDMYLLILQHFLLHATPPDSASQGLGPSLL RGRLPTLLHLGRLALWGLGMCCYVFSAQQLQAAQVSPDDISLGFLVRAKGVVPGSTAPLE FLHITFQCFFAAFYLALSADVPPALLRHLFNCGRPGNSPMARLLPTMCIQASEGKDSSVA ALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKALLRRQACARWCLARSLRKHFH SIPPAAPGEAKSVHAMPGFIWLIRSLYEMQEERLARKAARGLNVGHLKLTFCSVGPTECA ALAFVLQHLRRPVALQLDYNSVGDIGVEQLLPCLGVCKALYLRDNNISDRGICKLIECAL HCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGLRGNTS LQFLGFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEEL CLEENHLQDEGVCSLAEGLKKNSSLKILKLSNNCITYLGAEALLQALERNDTILEVWLRG NTFSLEEVDKLGCRDTRLLL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolNOD2
Gene SynonymACUG; BLAU; CARD15; CD; CLR16.3; IBD1; NLRC2; NOD2B; PSORAS1
Chromosome16
Locus Map16q21
Title Molecular mechanisms regulating the synergism between IL-32gamma and NOD for the activation of eosinophils .
Author Wong CK, Dong J and Lam CW.
Journal J. Leukoc. Biol. 95 (4), 631-642 (2014)
Title The Nod1, Nod2, and Rip2 axis contributes to host immune defense against intracellular Acinetobacter baumannii infection .
Author Bist P, Dikshit N, Koh TH, Mortellaro A, Tan TT and Sukumaran B.
Journal Infect. Immun. 82 (3), 1112-1122 (2014)
Title The role of NOD2 in murine and human melioidosis .
Author Myers ND, Chantratita N, Berrington WR, Chierakul W, Limmathurotsakul D, Wuthiekanun V, Robertson JD, Liggitt HD, Peacock SJ, Skerrett SJ and West TE.
Journal J. Immunol. 192 (1), 300-307 (2014)
Title Functional characterization of two novel 5' untranslated exons reveals a complex regulation of NOD2 protein expression .
Author Rosenstiel P, Huse K, Franke A, Hampe J, Reichwald K, Platzer C, Roberts RG, Mathew CG, Platzer M and Schreiber S.
Journal BMC Genomics 8, 472 (2007)
Title Early-onset sarcoidosis and CARD15 mutations with constitutive nuclear factor-kappaB activation: common genetic etiology with Blau syndrome .
Author Kanazawa N, Okafuji I, Kambe N, Nishikomori R, Nakata-Hizume M, Nagai S, Fuji A, Yuasa T, Manki A, Sakurai Y, Nakajima M, Kobayashi H, Fujiwara I, Tsutsumi H, Utani A, Nishigori C, Heike T, Nakahata
Journal Blood 105 (3), 1195-1197 (2005)
Title CARD15 mutations in Blau syndrome .
Author Miceli-Richard C, Lesage S, Rybojad M, Prieur AM, Manouvrier-Hanu S, Hafner R, Chamaillard M, Zouali H, Thomas G and Hugot JP.
Journal Nat. Genet. 29 (1), 19-20 (2001)
Title Association of NOD2 leucine-rich repeat variants with susceptibility to Crohn's disease .
Author Hugot JP, Chamaillard M, Zouali H, Lesage S, Cezard JP, Belaiche J, Almer S, Tysk C, O'Morain CA, Gassull M, Binder V, Finkel Y, Cortot A, Modigliani R, Laurent-Puig P, Gower-Rousseau C, Macry J, Colombel JF, Sahbatou M and Thomas G.
Journal Nature 411 (6837), 599-603 (2001)
Title Susceptibility locus for inflammatory bowel disease on chromosome 16 has a role in Crohn's disease, but not in ulcerative colitis .
Author Ohmen JD, Yang HY, Yamamoto KK, Zhao HY, Ma Y, Bentley LG, Huang Z, Gerwehr S, Pressman S, McElree C, Targan S, Rotter JI and Fischel-Ghodsian N.
Journal Hum. Mol. Genet. 5 (10), 1679-1683 (1996)
Title Mapping of a susceptibility locus for Crohn's disease on chromosome 16 .
Author Hugot JP, Laurent-Puig P, Gower-Rousseau C, Olson JM, Lee JC, Beaugerie L, Naom I, Dupas JL, Van Gossum A, Orholm M, Bonaiti-Pellie C, Weissenbach J, Mathew CG, Lennard-Jones JE, Cortot A, Colombel JF and Thomas G.
Journal Nature 379 (6568), 821-823 (1996)
Title Molecular evidence for two forms of Crohn disease .
Author Gilberts EC, Greenstein AJ, Katsel P, Harpaz N and Greenstein RJ.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (26), 12721-12724 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.