• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens nucleotide-binding oligomerization domain containing 2 (NOD2), mRNA.


RefSeq Accession Definition Services Price Order
NM_022162 Homo sapiens nucleotide-binding oligomerization domain containing 2 (NOD2), mRNA. ORF Sequence $1093.05
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_022162.1, 11545911
Length 4485 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens nucleotide-binding oligomerization domain containing 2 (NOD2), mRNA.
Product nucleotide-binding oligomerization domain-containing protein 2
Comment

Summary: This gene is a member of the Nod1/Apaf-1 family and encodes a protein with two caspase recruitment (CARD) domains and six leucine-rich repeats (LRRs). The protein is primarily expressed in the peripheral blood leukocytes. It plays a role in the immune response to intracellular bacterial lipopolysaccharides (LPS) by recognizing the muramyl dipeptide (MDP) derived from them and activating the NFKB protein. Mutations in this gene have been associated with Crohn disease and Blau syndrome. [provided by RefSeq, Jul 2008].

RefSeq NP_071445.1
CDS 106..3228
Misc Feature(1)94..96
Misc Feature(2)205..462
Misc Feature(3)205..462
Misc Feature(4)292..336
Misc Feature(5)505..717
Misc Feature(6)982..1494
Misc Feature(7)985..>1284
Misc Feature(8)2404..3201
Misc Feature(9)order(2404..2406,2410..2412,2419..2421,2425..2427,
Misc Feature(10)order(2413..2418,2575..2577,2743..2745,2827..2829,
Misc Feature(11)2476..2541
Misc Feature(12)<2488..>3006
Misc Feature(13)2551..2622
Misc Feature(14)2635..2700
Misc Feature(15)2719..2757
Misc Feature(16)2803..2865
Misc Feature(17)2887..2952
Misc Feature(18)2971..3033
Misc Feature(19)3055..3120
Misc Feature(20)3139..3201
Exon (1)1..178
Gene:NOD2
Gene Synonym:ACUG; BLAU; CARD15; CD; CLR16.3; IBD1; NLRC2; NOD2B; PSORAS1
Exon (2)179..645
Gene:NOD2
Gene Synonym:ACUG; BLAU; CARD15; CD; CLR16.3; IBD1; NLRC2; NOD2B; PSORAS1
Exon (3)646..751
Gene:NOD2
Gene Synonym:ACUG; BLAU; CARD15; CD; CLR16.3; IBD1; NLRC2; NOD2B; PSORAS1
Exon (4)752..2567
Gene:NOD2
Gene Synonym:ACUG; BLAU; CARD15; CD; CLR16.3; IBD1; NLRC2; NOD2B; PSORAS1
Exon (5)2568..2651
Gene:NOD2
Gene Synonym:ACUG; BLAU; CARD15; CD; CLR16.3; IBD1; NLRC2; NOD2B; PSORAS1
Exon (6)2652..2735
Gene:NOD2
Gene Synonym:ACUG; BLAU; CARD15; CD; CLR16.3; IBD1; NLRC2; NOD2B; PSORAS1
Exon (7)2736..2819
Gene:NOD2
Gene Synonym:ACUG; BLAU; CARD15; CD; CLR16.3; IBD1; NLRC2; NOD2B; PSORAS1
Exon (8)2820..2903
Gene:NOD2
Gene Synonym:ACUG; BLAU; CARD15; CD; CLR16.3; IBD1; NLRC2; NOD2B; PSORAS1
Exon (9)2904..2987
Gene:NOD2
Gene Synonym:ACUG; BLAU; CARD15; CD; CLR16.3; IBD1; NLRC2; NOD2B; PSORAS1
Exon (10)2988..3071
Gene:NOD2
Gene Synonym:ACUG; BLAU; CARD15; CD; CLR16.3; IBD1; NLRC2; NOD2B; PSORAS1
Exon (11)3072..3155
Gene:NOD2
Gene Synonym:ACUG; BLAU; CARD15; CD; CLR16.3; IBD1; NLRC2; NOD2B; PSORAS1
Exon (12)3156..4485
Gene:NOD2
Gene Synonym:ACUG; BLAU; CARD15; CD; CLR16.3; IBD1; NLRC2; NOD2B; PSORAS1
Translation MGEEGGSASHDEEERASVLLGHSPGCEMCSQEAFQAQRSQLVELLVSGSLEGFESVLDWL LSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLH GCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQR ARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEAATCKKYMAKLRTTVSAQSRFLSTY DGAETLCLEDIYTENVLEVWADVGMAGPPQKSPATLGLEELFSTPGHLNDDADTVLVVGE AGSGKSTLLQRLHLLWAAGQDFQEFLFVFPFSCRQLQCMAKPLSVRTLLFEHCCWPDVGQ EDIFQLLLDHPDRVLLTFDGFDEFKFRFTDRERHCSPTDPTSVQTLLFNLLQGNLLKNAR KVVTSRPAAVSAFLRKYIRTEFNLKGFSEQGIELYLRKRHHEPGVADRLIRLLQETSALH GLCHLPVFSWMVSKCHQELLLQEGGSPKTTTDMYLLILQHFLLHATPPDSASQGLGPSLL RGRLPTLLHLGRLALWGLGMCCYVFSAQQLQAAQVSPDDISLGFLVRAKGVVPGSTAPLE FLHITFQCFFAAFYLALSADVPPALLRHLFNCGRPGNSPMARLLPTMCIQASEGKDSSVA ALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKALLRRQACARWCLARSLRKHFH SIPPAAPGEAKSVHAMPGFIWLIRSLYEMQEERLARKAARGLNVGHLKLTFCSVGPTECA ALAFVLQHLRRPVALQLDYNSVGDIGVEQLLPCLGVCKALYLRDNNISDRGICKLIECAL HCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGLRGNTS LQFLGFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEEL CLEENHLQDEGVCSLAEGLKKNSSLKILKLSNNCITYLGAEALLQALERNDTILEVWLRG NTFSLEEVDKLGCRDTRLLL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
10+dbSNP:
10+, tdbSNP:5743265
15+c, gdbSNP:199475910
47..48+a, gdbSNP:2076752
47+a, gdbSNP:5743266
48+c, tdbSNP:139485985
53+c, tdbSNP:188341692
92+c, tdbSNP:117611225
118+c, gdbSNP:140977130
141+a, gdbSNP:149939201
165+c, tdbSNP:144993105
176+c, tdbSNP:149122717
218+dbSNP:
218+g, tdbSNP:104895487
232+a, gdbSNP:200089552
245+c, tdbSNP:201586544
305+c, gdbSNP:146149433
320+a, gdbSNP:138881230
346+c, gdbSNP:34936594
378+c, tdbSNP:146923251
379+a, gdbSNP:187264529
408+a, gdbSNP:138041175
418+a, gdbSNP:113706344
419+c, tdbSNP:202052365
420+a, gdbSNP:104895419
434+c, tdbSNP:35095295
442+a, gdbSNP:104895468
444+c, tdbSNP:138889062
479+c, tdbSNP:149390911
485+c, tdbSNP:146395646
494+c, gdbSNP:200160605
517+a, cdbSNP:184502667
518+a, gdbSNP:104895456
523+a, gdbSNP:34684955
565+a, gdbSNP:146054564
569+a, tdbSNP:148753593
574+c, tdbSNP:104895420
581+a, gdbSNP:150996156
589..590+gcatgggagcggggtttca, tcagccagtatgaatgtgatgaaatcaggtdbSNP:45575333
589+a, gdbSNP:139571975
624+a, gdbSNP:77153279
635+c, tdbSNP:144368009
639+c, gdbSNP:2067085
647+dbSNP:
647+a, cdbSNP:141414002
671+c, tdbSNP:61755182
672+a, gdbSNP:144887729
680+c, tdbSNP:149071116
702+c, tdbSNP:201115206
730+c, tdbSNP:143080077
738+c, tdbSNP:5743269
808+dbSNP:
808+c, tdbSNP:104895422
809+g, tdbSNP:201790577
824+a, gdbSNP:202190367
839+c, tdbSNP:148516118
848+g, tdbSNP:104895423
849+a, gdbSNP:145694647
851+a, gdbSNP:117836686
907+c, tdbSNP:2066842
921+c, tdbSNP:35090774
941+a, cdbSNP:200744970
944+a, gdbSNP:146074127
971+a, gdbSNP:5743271
976+a, gdbSNP:104895424
980+c, tdbSNP:149338478
986+c, gdbSNP:104895425
1007+c, tdbSNP:104895426
1025+c, tdbSNP:191901394
1032+a, gdbSNP:144738371
1034+a, gdbSNP:148526508
1036+c, tdbSNP:104895427
1055+c, tdbSNP:199975570
1059+a, gdbSNP:199951979
1064+a, gdbSNP:201591164
1105+c, tdbSNP:104895462
1106+a, gdbSNP:104895461
1110+c, gdbSNP:7498256
1134+c, gdbSNP:144439629
1136+c, tdbSNP:199475912
1147+c, gdbSNP:104895428
1160+a, gdbSNP:5743272
1170+a, gdbSNP:104895488
1172+c, tdbSNP:201107567
1175+a, cdbSNP:104895469
1192+a, tdbSNP:104895470
1213+c, tdbSNP:199858111
1222+c, tdbSNP:145293873
1251+c, g, tdbSNP:104895476
1252+a, gdbSNP:104895477
1253+a, gdbSNP:104895493
1273+a, gdbSNP:147283871
1276+c, tdbSNP:104895481
1282+c, tdbSNP:140716236
1283+a, gdbSNP:140918872
1295+c, tdbSNP:150078153
1299+c, tdbSNP:5743273
1346+a, gdbSNP:104895429
1364+a, gdbSNP:199475913
1374+g, tdbSNP:77966199
1386+a, gdbSNP:104895430
1390+a, gdbSNP:144827713
1397+c, tdbSNP:104895431
1398+g, tdbSNP:145834617
1400+c, tdbSNP:2076754
1421+a, gdbSNP:143110172
1425+c, tdbSNP:143395754
1426+a, gdbSNP:104895432
1431+c, tdbSNP:151315883
1461+c, tdbSNP:186719861
1471+c, tdbSNP:104895433
1482+c, tdbSNP:2066843
1492+c, gdbSNP:104895482
1494+c, tdbSNP:200656015
1495+g, tdbSNP:104895492
1510+c, tdbSNP:104895460
1516+c, tdbSNP:1078327
1547+a, gdbSNP:104895494
1556+a, cdbSNP:201712814
1558+c, tdbSNP:5743274
1574+g, tdbSNP:104895480
1589+a, gdbSNP:104895478
1592+a, tdbSNP:104895472
1614+a, gdbSNP:104895434
1643+c, tdbSNP:104895473
1686+c, gdbSNP:104895435
1702+c, tdbSNP:147417132
1706+g, tdbSNP:139663808
1708+c, tdbSNP:145190613
1753+c, gdbSNP:104895471
1776+c, tdbSNP:35422070
1777..1782+, ctgggcdbSNP:104895436
1794+c, tdbSNP:111608429
1864+c, tdbSNP:104895479
1866+a, cdbSNP:1861759
1879+a, gdbSNP:148683734
1892+c, tdbSNP:142077546
1893+a, gdbSNP:104895437
1896+a, gdbSNP:140312093
1918+a, cdbSNP:104895474
1938+c, tdbSNP:61736932
1939+a, gdbSNP:104895438
1940+c, tdbSNP:104895439
1944+c, tdbSNP:149870902
1955+a, tdbSNP:146440229
2026+a, gdbSNP:199770660
2049+c, gdbSNP:78848722
2061+a, gdbSNP:141355588
2074+a, gdbSNP:150236752
2084+c, gdbSNP:111400183
2108+c, tdbSNP:5743275
2109+a, gdbSNP:199475914
2115+a, cdbSNP:104895475
2129+c, tdbSNP:138958152
2151+g, tdbSNP:149002807
2155+c, tdbSNP:5743276
2156+a, gdbSNP:114664276
2162+a, cdbSNP:201709367
2179+a, gdbSNP:143782684
2209+c, tdbSNP:2066844
2210+a, gdbSNP:139104022
2212+c, tdbSNP:5743277
2228+a, gdbSNP:35285618
2242+c, tdbSNP:104895440
2243+a, gdbSNP:104895483
2252+a, gdbSNP:200035357
2273+c, tdbSNP:201076024
2279+c, gdbSNP:5743278
2285+c, tdbSNP:104895489
2286+a, gdbSNP:144468550
2301+c, tdbSNP:6413461
2309+c, tdbSNP:139097081
2319+c, gdbSNP:143963486
2325+c, tdbSNP:104895441
2334+c, gdbSNP:146458676
2335+c, tdbSNP:140876663
2367+a, gdbSNP:199475915
2369+c, tdbSNP:61747625
2378+c, tdbSNP:104895442
2383+c, tdbSNP:3813758
2437+a, gdbSNP:104895443
2473+c, tdbSNP:62029861
2474+a, gdbSNP:5743279
2476+c, tdbSNP:104895484
2477+a, gdbSNP:104895464
2481+c, tdbSNP:5743280
2482+a, gdbSNP:104895444
2511+g, tdbSNP:104895495
2523+c, gdbSNP:199475916
2531+a, gdbSNP:61736931
2575+dbSNP:
2575+a, gdbSNP:61755272
2580+c, gdbSNP:104895485
2629+c, tdbSNP:146313066
2632+a, gdbSNP:104895445
2651+c, tdbSNP:104895486
2660+dbSNP:
2660+a, gdbSNP:104895467
2663+a, gdbSNP:104895446
2676+c, tdbSNP:144083291
2687+a, gdbSNP:148246515
2692+a, gdbSNP:104895447
2720+a, gdbSNP:201806207
2724+c, tdbSNP:104895448
2752+dbSNP:
2752+a, cdbSNP:146276010
2782+g, tdbSNP:201884393
2792+a, gdbSNP:201831159
2804+c, tdbSNP:199552944
2809+a, cdbSNP:201035873
2811+g, tdbSNP:200428513
2817+a, gdbSNP:142559533
2823+dbSNP:
2823+c, tdbSNP:58586167
2824+c, tdbSNP:104895490
2827+c, g, tdbSNP:2066845
2828+c, gdbSNP:142376491
2844+c, tdbSNP:104895451
2858+a, cdbSNP:104895452
2876+a, gdbSNP:104895453
2895+a, gdbSNP:139886679
2907+dbSNP:
2907+a, gdbSNP:149691662
2920+a, gdbSNP:201781416
2922+c, tdbSNP:104895454
2968+a, gdbSNP:5743291
3002+dbSNP:
3002+a, gdbSNP:189453919
3019+a, gdbSNP:104895455
3026+c, tdbSNP:200463498
3030+c, tdbSNP:104895463
3031+a, gdbSNP:148561632
3038+a, gdbSNP:104895457
3082+dbSNP:
3082+a, gdbSNP:142904241
3083+a, gdbSNP:147750423
3092+a, cdbSNP:142614284
3120..3121+c, gdbSNP:111403064
3121..3122+, cdbSNP:2066847
3121+c, gdbSNP:199883290
3122..3123+, cdbSNP:5743293
3122+, cdbSNP:41450053
3125..3126+c, tdbSNP:112436597
3157+dbSNP:
3157+c, tdbSNP:146435555
3160+c, g, tdbSNP:104895491
3161+g, tdbSNP:5743295
3198+c, tdbSNP:201214915
3199+a, gdbSNP:147874812
3236+a, gdbSNP:199475923
3237+a, gdbSNP:104895459
3248+a, gdbSNP:5743296
3284+c, tdbSNP:112011764
3308+c, tdbSNP:199475924
3317+c, tdbSNP:184545855
3360..3361+, gdbSNP:35980453
3420+c, tdbSNP:199475925
3442+c, tdbSNP:199475926
3507+c, tdbSNP:140956945
3625+a, cdbSNP:3135499
3694+a, tdbSNP:188988267
3749+c, tdbSNP:5743297
3848+a, gdbSNP:116213743
3968+g, tdbSNP:5743298
3974+a, cdbSNP:145051635
4027+c, tdbSNP:114899313
4079+c, tdbSNP:60727336
4105+a, cdbSNP:140643942
4218+c, tdbSNP:192842874
4251+c, tdbSNP:5743299
4252+a, gdbSNP:113884530
4274+c, tdbSNP:145816297
4358+a, gdbSNP:138313319
4384+a, gdbSNP:3135500
Gene SymbolNOD2
Gene SynonymACUG; BLAU; CARD15; CD; CLR16.3; IBD1; NLRC2; NOD2B; PSORAS1
Chromosome16
Locus Map16q21
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_022162 Homo sapiens nucleotide-binding oligomerization domain containing 2 (NOD2), mRNA. Full Length $1569.75
ORF Sequence $1093.05
Title NOD2 gene mutations associate weakly with ulcerative colitis but not with Crohn's disease in Indian patients with inflammatory bowel disease .
Author Pugazhendhi,S., Santhanam,S., Venkataraman,J., Creveaux,I. and Ramakrishna,B.S.
Journal Gene 512 (2), 309-313 (2013)
Title Association of a NOD2 gene polymorphism and T-helper 17 cells with presumed ocular toxoplasmosis .
Author Dutra,M.S., Bela,S.R., Peixoto-Rangel,A.L., Fakiola,M., Cruz,A.G., Gazzinelli,A., Quites,H.F., Bahia-Oliveira,L.M., Peixe,R.G., Campos,W.R., Higino-Rocha,A.C., Miller,N.E., Blackwell,J.M., Antonelli,L.R. and Gazzinelli,R.T.
Journal J. Infect. Dis. 207 (1), 152-163 (2013)
Title A discrete ubiquitin-mediated network regulates the strength of NOD2 signaling .
Author Tigno-Aranjuez,J.T., Bai,X. and Abbott,D.W.
Journal Mol. Cell. Biol. 33 (1), 146-158 (2013)
Title Regulation of Salmonella flagellin-induced interleukin-8 in intestinal epithelial cells by muramyl dipeptide .
Author Huang,F.C.
Journal Cell. Immunol. 278 (1-2), 1-9 (2012)
Title Early-onset sarcoidosis and CARD15 mutations with constitutive nuclear factor-kappaB activation: common genetic etiology with Blau syndrome .
Author Kanazawa,N., Okafuji,I., Kambe,N., Nishikomori,R., Nakata-Hizume,M., Nagai,S., Fuji,A., Yuasa,T., Manki,A., Sakurai,Y., Nakajima,M., Kobayashi,H., Fujiwara,I., Tsutsumi,H., Utani,A., Nishigori,C., Heike,T., Nakahata,T. and Miyachi,Y.
Journal Blood 105 (3), 1195-1197 (2005)
Title CARD15 mutations in Blau syndrome .
Author Miceli-Richard,C., Lesage,S., Rybojad,M., Prieur,A.M., Manouvrier-Hanu,S., Hafner,R., Chamaillard,M., Zouali,H., Thomas,G. and Hugot,J.P.
Journal Nat. Genet. 29 (1), 19-20 (2001)
Title Association of NOD2 leucine-rich repeat variants with susceptibility to Crohn's disease .
Author Hugot,J.P., Chamaillard,M., Zouali,H., Lesage,S., Cezard,J.P., Belaiche,J., Almer,S., Tysk,C., O'Morain,C.A., Gassull,M., Binder,V., Finkel,Y., Cortot,A., Modigliani,R., Laurent-Puig,P., Gower-Rousseau,C., Macry,J., Colombel,J.F., Sahbatou,M. and Thomas,G.
Journal Nature 411 (6837), 599-603 (2001)
Title Susceptibility locus for inflammatory bowel disease on chromosome 16 has a role in Crohn's disease, but not in ulcerative colitis .
Author Ohmen,J.D., Yang,H.Y., Yamamoto,K.K., Zhao,H.Y., Ma,Y., Bentley,L.G., Huang,Z., Gerwehr,S., Pressman,S., McElree,C., Targan,S., Rotter,J.I. and Fischel-Ghodsian,N.
Journal Hum. Mol. Genet. 5 (10), 1679-1683 (1996)
Title Mapping of a susceptibility locus for Crohn's disease on chromosome 16 .
Author Hugot,J.P., Laurent-Puig,P., Gower-Rousseau,C., Olson,J.M., Lee,J.C., Beaugerie,L., Naom,I., Dupas,J.L., Van Gossum,A., Orholm,M., Bonaiti-Pellie,C., Weissenbach,J., Mathew,C.G., Lennard-Jones,J.E., Cortot,A., Colombel,J.F. and Thomas,G.
Journal Nature 379 (6568), 821-823 (1996)
Title Molecular evidence for two forms of Crohn disease .
Author Gilberts,E.C., Greenstein,A.J., Katsel,P., Harpaz,N. and Greenstein,R.J.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (26), 12721-12724 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878