• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens dipeptidase 3 (DPEP3), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_022357 Homo sapiens dipeptidase 3 (DPEP3), transcript variant 1, mRNA. ORF Sequence $447.18
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_022357.3, 193211607
Length 1756 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens dipeptidase 3 (DPEP3), transcript variant 1, mRNA.
Product dipeptidase 3 isoform a precursor
Comment

Summary: This gene encodes a membrane-bound glycoprotein from the family of dipeptidases involved in hydrolytic metabolism of various dipeptides, including penem and carbapenem beta-lactam antibiotics. This gene is located on chromosome 16 in a cluster with another member of this family. Alternatively spliced transcript variants that encode different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (a).


CCDS Note: The translation start codon selected for this CCDS is conserved in primates. A possible downstream translation start codon, which is better conserved across species and is consistent with the dipeptidase 2 family member, would reduce the protein length by 25 aa. No experimental evidence exists regarding which start codon is used.


##Evidence-Data-START## Transcript exon combination :: AK057401.1, BC057789.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025085 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_071752.3
CDS 95..1636
Misc Feature(1)443..1381
Misc Feature(2)order(458..460,464..466,596..598,755..757,974..976,
Misc Feature(3)order(602..604,629..637,641..646,653..655,665..667,
Exon (1)1..456
Gene:DPEP3
Gene Synonym:MBD3
Exon (2)457..583
Gene:DPEP3
Gene Synonym:MBD3
Exon (3)584..713
Gene:DPEP3
Gene Synonym:MBD3
Exon (4)714..855
Gene:DPEP3
Gene Synonym:MBD3
Exon (5)856..925
Gene:DPEP3
Gene Synonym:MBD3
Exon (6)926..1102
Gene:DPEP3
Gene Synonym:MBD3
Exon (7)1103..1187
Gene:DPEP3
Gene Synonym:MBD3
Exon (8)1188..1263
Gene:DPEP3
Gene Synonym:MBD3
Exon (9)1264..1399
Gene:DPEP3
Gene Synonym:MBD3
Exon (10)1400..1738
Gene:DPEP3
Gene Synonym:MBD3
Translation MIRTPLSASAHRLLLPGSRGRPPRNMQPTGREGSRALSRRYLRRLLLLLLLLLLRQPVTR AETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVD GHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVR LALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLG VRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLI RRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANV STVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQG VLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQP TNRVPWRSSNASPYLVPGLVAAATIPTFTQWLC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(59)-dbSNP:
complement(59)-t, cdbSNP:142218554
complement(161)-g, adbSNP:200300395
complement(313)-t, cdbSNP:201416021
complement(342)-g, adbSNP:138005567
complement(420)-g, adbSNP:150317704
complement(435)-t, cdbSNP:142825117
complement(455)-c, adbSNP:201962509
complement(532)-dbSNP:
complement(532)-g, adbSNP:56921747
complement(533)-g, adbSNP:200788983
complement(541)-t, cdbSNP:139520527
complement(555)-t, cdbSNP:200922436
complement(566)-t, cdbSNP:7189697
complement(571)-g, adbSNP:61743289
complement(628)-dbSNP:
complement(628)-g, adbSNP:34504376
complement(629)-t, cdbSNP:200103050
complement(633)-t, cdbSNP:150674946
complement(665)-g, adbSNP:183104878
complement(722)-dbSNP:
complement(722)-t, cdbSNP:149138054
complement(815)-t, cdbSNP:201009884
complement(818)-g, adbSNP:142001942
complement(854)-g, adbSNP:201915242
complement(899)-dbSNP:
complement(899)-t, cdbSNP:16957670
complement(948)-dbSNP:
complement(948)-t, cdbSNP:201970507
complement(964)-t, cdbSNP:200690892
complement(981)-g, adbSNP:147119305
complement(1004)-g, cdbSNP:57136942
complement(1067)-g, adbSNP:140582991
complement(1082)-t, cdbSNP:113700215
complement(1093)-c, adbSNP:75651517
complement(1121)-dbSNP:
complement(1121)-t, cdbSNP:140027869
complement(1232)-dbSNP:
complement(1232)-t, cdbSNP:199567405
complement(1255)-g, cdbSNP:200372942
complement(1344)-dbSNP:
complement(1344)-t, cdbSNP:202154169
complement(1362)-t, cdbSNP:181650862
complement(1381)-g, adbSNP:150691835
complement(1425)-dbSNP:
complement(1425)-t, cdbSNP:201837263
complement(1466)-g, adbSNP:187280631
complement(1474)-t, gdbSNP:148862553
complement(1484)-t, cdbSNP:199987960
complement(1501)-g, cdbSNP:150149313
complement(1539)-t, cdbSNP:142524684
complement(1596)-g, adbSNP:140842438
Gene SymbolDPEP3
Gene SynonymMBD3
Chromosome16
Locus Map16q22.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001129758 Homo sapiens dipeptidase 3 (DPEP3), transcript variant 2, mRNA. Full Length $508.37
ORF Sequence $446.31
NM_022357 Homo sapiens dipeptidase 3 (DPEP3), transcript variant 1, mRNA. Full Length $509.24
ORF Sequence $447.18
Title Genome-wide association analysis of metabolic traits in a birth cohort from a founder population .
Author Sabatti,C., Service,S.K., Hartikainen,A.L., Pouta,A., Ripatti,S., Brodsky,J., Jones,C.G., Zaitlen,N.A., Varilo,T., Kaakinen,M., Sovio,U., Ruokonen,A., Laitinen,J., Jakkula,E., Coin,L., Hoggart,C., Collins,A., Turunen,H., Gabriel,S., Elliot,P., McCarthy,M.I., Daly,M.J., Jarvelin,M.R., Freimer,N.B. and Peltonen,L.
Journal Nat. Genet. 41 (1), 35-46 (2009)
Title The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment .
Author Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J., Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B., Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E., Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S., Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C., Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V., Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K., Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z., Goddard,A., Wood,W.I., Godowski,P. and Gray,A.
Journal Genome Res. 13 (10), 2265-2270 (2003)
Title Identification of two additional members of the membrane-bound dipeptidase family .
Author Habib,G.M., Shi,Z.Z., Cuevas,A.A. and Lieberman,M.W.
Journal FASEB J. 17 (10), 1313-1315 (2003)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878