• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_022436 Homo sapiens ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5), mRNA. GenEZ ORF Cloning In-stock $639.00 $590.00 15

*Business Day

Related Services

RefSeq Version NM_022436.2, 14141174
Length 2740 bp
Structure linear
Update Date 17-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5), mRNA.
Product ATP-binding cassette sub-family G member 5
Comment

Summary: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. The protein encoded by this gene functions as a half-transporter to limit intestinal absorption and promote biliary excretion of sterols. It is expressed in a tissue-specific manner in the liver, colon, and intestine. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG8. Mutations in this gene may contribute to sterol accumulation and atheroschlerosis, and have been observed in patients with sitosterolemia. [provided by RefSeq, Jul 2008].

RefSeq NP_071881.1
CDS 141..2096
Misc Feature(1)78..80
Misc Feature(2)288..965
Misc Feature(3)288..965
Misc Feature(4)318..2075
Misc Feature(5)396..419
Misc Feature(6)order(405..410,414..422,540..542,789..794,888..890)
Misc Feature(7)531..542
Misc Feature(8)717..746
Misc Feature(9)777..794
Misc Feature(10)801..812
Misc Feature(11)876..896
Misc Feature(12)1242..1880
Misc Feature(13)1290..1352
Misc Feature(14)1404..1466
Misc Feature(15)1527..1589
Misc Feature(16)1650..1712
Misc Feature(17)1725..1787
Misc Feature(18)2010..2072
Exon (1)1..283
Gene:ABCG5
Gene Synonym:STSL
Exon (2)284..405
Gene:ABCG5
Gene Synonym:STSL
Exon (3)406..542
Gene:ABCG5
Gene Synonym:STSL
Exon (4)543..641
Gene:ABCG5
Gene Synonym:STSL
Exon (5)642..774
Gene:ABCG5
Gene Synonym:STSL
Exon (6)775..914
Gene:ABCG5
Gene Synonym:STSL
Exon (7)915..1044
Gene:ABCG5
Gene Synonym:STSL
Exon (8)1045..1258
Gene:ABCG5
Gene Synonym:STSL
Exon (9)1259..1464
Gene:ABCG5
Gene Synonym:STSL
Exon (10)1465..1603
Gene:ABCG5
Gene Synonym:STSL
Exon (11)1604..1789
Gene:ABCG5
Gene Synonym:STSL
Exon (12)1790..1902
Gene:ABCG5
Gene Synonym:STSL
Exon (13)1903..2740
Gene:ABCG5
Gene Synonym:STSL
Translation MGDLSSLTPGGSMGLQVNRGSQSSLEGAPATAPEPHSLGILHASYSVSHRVRPWWDITSC RQQWTRQILKDVSLYVESGQIMCILGSSGSGKTTLLDAMSGRLGRAGTFLGEVYVNGRAL RREQFQDCFSYVLQSDTLLSSLTVRETLHYTALLAIRRGNPGSFQKKVEAVMAELSLSHV ADRLIGNYSLGGISTGERRRVSIAAQLLQDPKVMLFDEPTTGLDCMTANQIVVLLVELAR RNRIVVLTIHQPRSELFQLFDKIAILSFGELIFCGTPAEMLDFFNDCGYPCPEHSNPFDF YMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICHKTLKNIERMKHLKTLPMVPFKTKD SPGVFSKLGVLLRRVTRNLVRNKLAVITRLLQNLIMGLFLLFFVLRVRSNVLKGAIQDRV GLLYQFVGATPYTGMLNAVNLFPVLRAVSDQESQDGLYQKWQMMLAYALHVLPFSVVATM IFSSVCYWTLGLHPEVARFGYFSAALLAPHLIGEFLTLVLLGIVQNPNIVNSVVALLSIA GVLVGSGFLRNIQEMPIPFKIISYFTFQKYCSEILVVNEFYGLNFTCGSSNVSVTTNPMC AFTQGIQFIEKTCPGATSRFTMNFLILYSFIPALVILGIVVFKIRDHLISR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(10)-dbSNP:
complement(10)-g, adbSNP:115642007
complement(23)-t, gdbSNP:55853083
complement(35)-t, cdbSNP:189132480
complement(100)-g, adbSNP:369084669
complement(103)-t, gdbSNP:377117720
complement(110)-t, cdbSNP:56289199
complement(167)-g, adbSNP:72542428
complement(173)-c, adbSNP:200471843
complement(183)-g, cdbSNP:372312214
186+c, tdbSNP:387906912
complement(190)-c, adbSNP:72542427
complement(218)-c, adbSNP:144622073
complement(220)-g, cdbSNP:56204478
231+g, tdbSNP:187767254
complement(233)-g, adbSNP:368621082
complement(239)-t, cdbSNP:149907931
complement(247)-t, gdbSNP:201992386
complement(252)-g, cdbSNP:375829761
complement(256)-t, cdbSNP:371929020
complement(279)-c, adbSNP:72542426
complement(288)-dbSNP:
complement(288)-g, c, adbSNP:6756629
complement(289)-t, cdbSNP:200036521
complement(297)-g, adbSNP:372772883
complement(309)-t, cdbSNP:144206840
complement(322)-t, cdbSNP:149599171
complement(366)-t, cdbSNP:368811625
369+g, tdbSNP:119480070
complement(375)-t, cdbSNP:142125966
complement(378)-t, gdbSNP:373819340
complement(433)-dbSNP:
complement(433)-g, cdbSNP:145164937
complement(465)-g, adbSNP:201889290
complement(467)-g, adbSNP:267599380
complement(476)-c, adbSNP:371387251
complement(504)-g, adbSNP:376227258
complement(548)-dbSNP:
complement(548)-g, adbSNP:141386201
complement(571)-g, adbSNP:376797531
complement(582)-g, adbSNP:143444046
complement(649)-dbSNP:
complement(649)-t, gdbSNP:145505499
complement(650)-g, adbSNP:147061424
complement(663)-t, gdbSNP:374055102
complement(687)-g, adbSNP:145300824
complement(701)-g, adbSNP:200727789
complement(704)-g, adbSNP:201251821
complement(706)-g, cdbSNP:201572746
complement(733)-t, cdbSNP:141828689
complement(735)-g, adbSNP:376129056
complement(761)-t, cdbSNP:146336941
complement(778)-dbSNP:
complement(778)-g, adbSNP:111535772
complement(808)-g, adbSNP:186904986
complement(834)-t, cdbSNP:141997221
complement(836)-g, adbSNP:72796720
complement(837)-t, cdbSNP:377497967
867+c, tdbSNP:119479066
complement(871)-g, adbSNP:371924715
complement(885)-t, cdbSNP:372682088
complement(891)-g, adbSNP:140111105
complement(895)-g, cdbSNP:369111229
complement(898)-t, cdbSNP:148186696
complement(901)-g, cdbSNP:142019608
921+dbSNP:
921+c, tdbSNP:186138834
complement(925)-t, c, adbSNP:78070897
complement(933)-t, gdbSNP:190380979
complement(935)-g, adbSNP:112926649
complement(967)-g, adbSNP:368800131
complement(974)-t, cdbSNP:373182673
complement(989)-g, adbSNP:370806483
complement(993)-t, cdbSNP:200772212
complement(999)-g, adbSNP:141033260
complement(1002)-t, cdbSNP:139264483
complement(1033)-g, adbSNP:377520529
complement(1037)-g, adbSNP:373237261
complement(1042)-t, cdbSNP:369826575
complement(1054)-dbSNP:
complement(1054)-g, adbSNP:143740796
complement(1060)-g, adbSNP:373926312
complement(1080)-g, adbSNP:142971825
complement(1097)-g, adbSNP:146131711
complement(1109)-c, adbSNP:369775776
complement(1120)-g, adbSNP:201302611
complement(1183)-c, adbSNP:374824368
complement(1184)-c, adbSNP:371319986
complement(1185)-t, adbSNP:368123646
complement(1189)-g, adbSNP:148131742
complement(1206)-g, adbSNP:374919194
complement(1291)-dbSNP:
complement(1291)-g, adbSNP:373409293
complement(1303)-g, adbSNP:149418765
complement(1304)-t, cdbSNP:145755348
1306+a, gdbSNP:119480069
complement(1311)-g, adbSNP:148997255
complement(1319)-g, adbSNP:144893516
complement(1350)-t, cdbSNP:200396635
complement(1357)-t, cdbSNP:375364242
complement(1358)-t, cdbSNP:146992652
1362+c, tdbSNP:119479065
complement(1363)-t, cdbSNP:143680435
complement(1368)-t, gdbSNP:115590670
complement(1391)-t, cdbSNP:146801512
1396+a, c, gdbSNP:119479067
complement(1411)-t, gdbSNP:368994670
complement(1424)-g, adbSNP:143972075
complement(1452)-t, cdbSNP:201552973
complement(1460)-t, adbSNP:150002815
complement(1466)-dbSNP:
complement(1466)-g, adbSNP:200597050
complement(1469)-g, adbSNP:201620171
complement(1470)-t, cdbSNP:375313472
complement(1476)-g, adbSNP:199689137
complement(1480)-g, c, adbSNP:200373089
complement(1487)-g, adbSNP:139361486
complement(1505)-g, adbSNP:141016088
complement(1506)-t, cdbSNP:200378113
complement(1538)-g, adbSNP:373514009
complement(1550)-g, adbSNP:369709495
complement(1551)-t, cdbSNP:143402711
complement(1559)-t, gdbSNP:377076958
complement(1565)-g, adbSNP:201506122
1572+a, gdbSNP:4076029
complement(1572)-t, cdbSNP:386590729
complement(1576)-g, adbSNP:143508969
complement(1606)-dbSNP:
complement(1606)-g, adbSNP:371933669
complement(1644)-g, adbSNP:79482684
complement(1668)-t, gdbSNP:199984328
complement(1675)-g, adbSNP:369647073
complement(1690)-g, cdbSNP:17031672
complement(1707)-t, cdbSNP:140899003
complement(1709)-g, adbSNP:376969021
complement(1710)-t, cdbSNP:200839584
complement(1758)-c, adbSNP:189943456
complement(1760)-t, cdbSNP:145527220
complement(1761)-t, cdbSNP:142109022
complement(1765)-g, adbSNP:191898631
complement(1768)-g, adbSNP:199862542
complement(1823)-dbSNP:
complement(1823)-g, adbSNP:374040301
complement(1851)-g, adbSNP:370371131
complement(1865)-g, adbSNP:376233323
complement(1873)-t, cdbSNP:146534033
complement(1883)-g, adbSNP:149027497
complement(1884)-t, cdbSNP:144973796
complement(1898)-g, adbSNP:141053836
complement(1911)-dbSNP:
complement(1911)-t, cdbSNP:201902491
complement(1926)-t, cdbSNP:144063868
complement(1946)-g, adbSNP:150716811
complement(1950)-g, cdbSNP:6720173
complement(1965)-t, cdbSNP:199967611
complement(1969)-t, gdbSNP:369053191
complement(1992)-g, adbSNP:137996263
complement(1996)-g, cdbSNP:374012053
complement(2004)-t, cdbSNP:140374206
complement(2010)-g, adbSNP:150401285
complement(2023)-t, cdbSNP:201698182
complement(2043)-c, adbSNP:184878933
complement(2059)-g, adbSNP:192910356
complement(2061)-g, cdbSNP:370772513
complement(2083)-c, adbSNP:140511481
complement(2134)-t, cdbSNP:377147892
complement(2138)-g, cdbSNP:374139177
complement(2168)-t, cdbSNP:77265083
complement(2184)-g, adbSNP:138271021
complement(2314)-, adbSNP:144452054
complement(2315)-, adbSNP:139045335
complement(2321)-c, adbSNP:376140340
complement(2381)-g, cdbSNP:114868704
complement(2387)-g, cdbSNP:188558738
complement(2389..2390)-, adbSNP:140489975
complement(2476)-t, gdbSNP:111172443
2476+g, tdbSNP:2278356
complement(2487)-g, adbSNP:183455219
complement(2495)-g, adbSNP:79475203
2512+a, gdbSNP:2278357
complement(2512)-g, adbSNP:112461781
complement(2530)-t, adbSNP:144382410
complement(2610)-t, cdbSNP:111650889
complement(2614)-t, cdbSNP:146758782
complement(2618)-t, cdbSNP:77105521
complement(2631)-g, adbSNP:77638440
complement(2636)-g, adbSNP:192476318
complement(2637)-t, cdbSNP:140623620
complement(2688)-t, cdbSNP:151005348
complement(2717)-g, adbSNP:144987434
2718+c, tdbSNP:4148195
Gene SymbolABCG5
Gene SynonymSTSL
Chromosome2
Locus Map2p21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_022436 Homo sapiens ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5), mRNA. In-stock $639.00 $590.00 15
XM_006712073 PREDICTED: Homo sapiens ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5), transcript variant X3, mRNA. On-demand $849.00 20
XM_005264480 PREDICTED: Homo sapiens ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5), transcript variant X1, mRNA. On-demand $699.00 18
XM_005264481 PREDICTED: Homo sapiens ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5), transcript variant X2, mRNA. On-demand $699.00 18
XM_006712074 PREDICTED: Homo sapiens ATP-binding cassette, sub-family G (WHITE), member 5 (ABCG5), transcript variant X4, mRNA. On-demand $549.00 14
Title Discovery and refinement of loci associated with lipid levels .
Author Willer CJ, Schmidt EM, Sengupta S, Peloso GM, Gustafsson S, Kanoni S, Ganna A, Chen J, Buchkovich ML, Mora S, Beckmann JS, Bragg-Gresham JL, Chang HY, Demirkan A, Den Hertog HM, Do R, Donnelly LA, Ehret GB, Esko T, Feitosa MF, Ferreira T, Fischer K, Fontanillas P, Fraser RM, Freitag DF, Gurdasani D, Heikkila K, Hypponen E, Isaacs A, Jackson AU, Johansson A, Johnson T, Kaakinen M, Kettunen J, Kleber ME, Li X, Luan J, Lyytikainen LP, Magnusson PK, Mangino M, Mihailov E, Montasser ME, Muller-Nurasyid M, Nolte IM, O'Connell JR, Palmer CD, Perola M, Petersen AK, Sanna S, Saxena R, Service SK, Shah S, Shungin D, Sidore C, Song C, Strawbridge RJ, Surakka I, Tanaka T, Teslovich TM, Thorleifsson G, Van den Herik EG, Voight BF, Volcik KA, Waite LL, Wong A, Wu Y, Zhang W, Absher D, Asiki G, Barroso I, Been LF, Bolton JL, Bonnycastle LL, Brambilla P, Burnett MS, Cesana G, Dimitriou M, Doney AS, Doring A, Elliott P, Epstein SE, Eyjolfsson GI, Gigante B, Goodarzi MO, Grallert H, Gravito ML, Groves CJ, Hallmans G, Hartikainen AL, Hayward C, Hernandez D, Hicks AA, Holm H, Hung YJ, Illig T, Jones MR, Kaleebu P, Kastelein JJ, Khaw KT, Kim E, Klopp N, Komulainen P, Kumari M, Langenberg C, Lehtimaki T, Lin SY, Lindstrom J, Loos RJ, Mach F, McArdle WL, Meisinger C, Mitchell BD, Muller G, Nagaraja R, Narisu N, Nieminen TV, Nsubuga RN, Olafsson I, Ong KK, Palotie A, Papamarkou T, Pomilla C, Pouta A, Rader DJ, Reilly MP, Ridker PM, Rivadeneira F, Rudan I, Ruokonen A, Samani N, Scharnagl H, Seeley J, Silander K, Stancakova A, Stirrups K, Swift AJ, Tiret L, Uitterlinden AG, van Pelt LJ, Vedantam S, Wainwright N, Wijmenga C, Wild SH, Willemsen G, Wilsgaard T, Wilson JF, Young EH, Zhao JH, Adair LS, Arveiler D, Assimes TL, Bandinelli S, Bennett F, Bochud M, Boehm BO, Boomsma DI, Borecki IB, Bornstein SR, Bovet P, Burnier M, Campbell H, Chakravarti A, Chambers JC, Chen YD, Collins FS, Cooper RS, Danesh J, Dedoussis G, de Faire U, Feranil AB, Ferrieres J, Ferrucci L, Freimer NB, Gieger C, Groop LC, Gudnason V, Gyllensten U, Hamsten A, Harris TB, Hingorani A, Hirschhorn JN, Hofman A, Hovingh GK, Hsiung CA, Humphries SE, Hunt SC, Hveem K, Iribarren C, Jarvelin MR, Jula A, Kahonen M, Kaprio J, Kesaniemi A, Kivimaki M, Kooner JS, Koudstaal PJ, Krauss RM, Kuh D, Kuusisto J, Kyvik KO, Laakso M, Lakka TA, Lind L, Lindgren CM, Martin NG, Marz W, McCarthy MI, McKenzie CA, Meneton P, Metspalu A, Moilanen L, Morris AD, Munroe PB, Njolstad I, Pedersen NL, Power C, Pramstaller PP, Price JF, Psaty BM, Quertermous T, Rauramaa R, Saleheen D, Salomaa V, Sanghera DK, Saramies J, Schwarz PE, Sheu WH, Shuldiner AR, Siegbahn A, Spector TD, Stefansson K, Strachan DP, Tayo BO, Tremoli E, Tuomilehto J, Uusitupa M, van Duijn CM, Vollenweider P, Wallentin L, Wareham NJ, Whitfield JB, Wolffenbuttel BH, Ordovas JM, Boerwinkle E, Palmer CN, Thorsteinsdottir U, Chasman DI, Rotter JI, Franks PW, Ripatti S, Cupples LA, Sandhu MS, Rich SS, Boehnke M, Deloukas P, Kathiresan S, Mohlke KL, Ingelsson E and Abecasis GR.
Journal Nat. Genet. 45 (11), 1274-1283 (2013)
Title Cooperative transcriptional activation of ATP-binding cassette sterol transporters ABCG5 and ABCG8 genes by nuclear receptors including Liver-X-Receptor .
Author Back SS, Kim J, Choi D, Lee ES, Choi SY and Han K.
Journal BMB Rep 46 (6), 322-327 (2013)
Title Genetic and functional identification of the likely causative variant for cholesterol gallstone disease at the ABCG5/8 lithogenic locus .
Author von Kampen O, Buch S, Nothnagel M, Azocar L, Molina H, Brosch M, Erhart W, von Schonfels W, Egberts J, Seeger M, Arlt A, Balschun T, Franke A, Lerch MM, Mayerle J, Kratzer W, Boehm BO, Huse K, Schniewind B, Tiemann K, Jiang ZY, Han TQ, Mittal B, Srivastava A, Fenger M, Jorgensen T, Schirin-Sokhan R, Tonjes A, Wittenburg H, Stumvoll M, Kalthoff H, Lammert F, Tepel J, Puschel K, Becker T, Schreiber S, Platzer M, Volzke H, Krawczak M, Miquel JF, Schafmayer
Journal Hepatology 57 (6), 2407-2417 (2013)
Title ATP-binding cassette sterol transporters are differentially expressed in normal and diseased human gallbladder .
Author Yoon JH, Choi HS, Jun DW, Yoo KS, Lee J, Yang SY and Kuver R.
Journal Dig. Dis. Sci. 58 (2), 431-439 (2013)
Title ATP-binding cassette transporter G5 and G8 polymorphisms and several environmental factors with serum lipid levels .
Author Li Q, Yin RX, Wei XL, Yan TT, Aung LH, Wu DF, Wu JZ, Lin WX, Liu CW and Pan SL.
Journal PLoS ONE 7 (5), E37972 (2012)
Title Identification of a gene, ABCG5, important in the regulation of dietary cholesterol absorption .
Author Lee MH, Lu K, Hazard S, Yu H, Shulenin S, Hidaka H, Kojima H, Allikmets R, Sakuma N, Pegoraro R, Srivastava AK, Salen G, Dean M and Patel SB.
Journal Nat. Genet. 27 (1), 79-83 (2001)
Title An ATP-binding cassette gene (ABCG5) from the ABCG (White) gene subfamily maps to human chromosome 2p21 in the region of the Sitosterolemia locus .
Author Shulenin S, Schriml LM, Remaley AT, Fojo S, Brewer B, Allikmets R and Dean M.
Journal Cytogenet. Cell Genet. 92 (3-4), 204-208 (2001)
Title Accumulation of dietary cholesterol in sitosterolemia caused by mutations in adjacent ABC transporters .
Author Berge KE, Tian H, Graf GA, Yu L, Grishin NV, Schultz J, Kwiterovich P, Shan B, Barnes R and Hobbs HH.
Journal Science 290 (5497), 1771-1775 (2000)
Title Mapping a gene involved in regulating dietary cholesterol absorption. The sitosterolemia locus is found at chromosome 2p21 .
Author Patel SB, Salen G, Hidaka H, Kwiterovich PO, Stalenhoef AF, Miettinen TA, Grundy SM, Lee MH, Rubenstein JS, Polymeropoulos MH and Brownstein MJ.
Journal J. Clin. Invest. 102 (5), 1041-1044 (1998)
Title Sitosterolemia .
Author Merkens,L.S., Myrie,S.B., Steiner,R.D. and Mymin,D.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.