• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens growth hormone 1 (GH1), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25686 Homo sapiens growth hormone 1 (GH1), transcript variant 2, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu25686C Homo sapiens growth hormone 1 (GH1), transcript variant 2, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_022559.3, 636576918
Length 609 bp
Structure linear
Update Date 21-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens growth hormone 1 (GH1), transcript variant 2, mRNA.
Product somatotropin isoform 2 precursor
Comment

Summary: The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) uses an alternate in-frame splice site in the central coding region, compared to variant 1. The encoded isoform (b) is shorter, compared to isoform 1.

RefSeq NP_072053.1
CDS 77..685
Misc Feature(1)179..676
Misc Feature(2)order(179..181,188..190,197..202,206..208,215..220,
Misc Feature(3)425..427
Misc Feature(4)557..559
Translation MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFNPQ TSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSN VYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKD MDKVETFLRIVQCRSVEGSCGF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolGH1
Gene SynonymGH; GH-N; GHN; hGH-N; IGHD1B
Chromosome17
Locus Map17q24.2
Title Determinants of GH resistance in malnutrition .
Author Fazeli PK and Klibanski A.
Journal J. Endocrinol. 220 (3), R57-R65 (2014)
Title Human metastatic melanoma cell lines express high levels of growth hormone receptor and respond to GH treatment .
Author Sustarsic EG, Junnila RK and Kopchick JJ.
Journal Biochem. Biophys. Res. Commun. 441 (1), 144-150 (2013)
Title The stress response to surgery and postoperative delirium: evidence of hypothalamic-pituitary-adrenal axis hyperresponsiveness and decreased suppression of the GH/IGF-1 Axis .
Author Cerejeira J, Batista P, Nogueira V, Vaz-Serra A and Mukaetova-Ladinska EB.
Journal J Geriatr Psychiatry Neurol 26 (3), 185-194 (2013)
Title Growth hormone (GH) activity is associated with increased serum oestradiol and reduced anti-Mullerian hormone in healthy male volunteers treated with GH and a GH antagonist .
Author Andreassen M, Frystyk J, Faber J, Kristensen LO and Juul A.
Journal Andrology 1 (4), 595-601 (2013)
Title Basic fibroblast growth factor upregulates expression of growth hormone gene through extracellular signal-regulated kinase 1/2 in GH4 cells .
Author Liu HZ, Luo P, Chen SH and Shang JH.
Journal Bratisl Lek Listy 114 (7), 376-379 (2013)
Title Isolated growth hormone (GH) deficiency type IA associated with a 45-kilobase gene deletion within the human GH gene cluster .
Author Akinci A, Kanaka C, Eble A, Akar N, Vidinlisan S and Mullis PE.
Journal J. Clin. Endocrinol. Metab. 75 (2), 437-441 (1992)
Title A native RNA secondary structure controls alternative splice-site selection and generates two human growth hormone isoforms .
Author Estes PA, Cooke NE and Liebhaber SA.
Journal J. Biol. Chem. 267 (21), 14902-14908 (1992)
Title Human growth hormone and extracellular domain of its receptor: crystal structure of the complex .
Author de Vos AM, Ultsch M and Kossiakoff AA.
Journal Science 255 (5042), 306-312 (1992)
Title Molecular cloning and nucleotide sequence of the human growth hormone structural gene .
Author Roskam WG and Rougeon F.
Journal Nucleic Acids Res. 7 (2), 305-320 (1979)
Title Human growth hormone: complementary DNA cloning and expression in bacteria .
Author Martial JA, Hallewell RA, Baxter JD and Goodman HM.
Journal Science 205 (4406), 602-607 (1979)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.