• THAT   AND
  • THAT   AND


Rattus norvegicus secretogranin II (chromogranin C) (Scg2), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_022669 Rattus norvegicus secretogranin II (chromogranin C) (Scg2), mRNA. Full Lenth $663.81
ORF Sequence $539.40
RefSeq Version NM_022669.1, 12083600
Length 2289 bp
Structure linear
Update Date 10-APR-2011
Organism Rattus norvegicus (Norway rat)
Definition Rattus norvegicus secretogranin II (chromogranin C) (Scg2), mRNA.
Product secretogranin-2 precursor
Comment

Summary: member of the chromogranin family of proteins that are localized to large dense core vesicles and are endoproteolytically processed to smaller neuropeptides [RGD].

RefSeq NP_073160.1
CDS 31..1890
Translation MTESKAYRFGAVLLLIHLIFLVPGTEAASFQRNQLLQKEPDLRLENVQKFPSPEMIRALE YIEKLRQQAHREESSPDYNPYQGISVPLQLKENGEESHLAESSRDVLSEDEWMRIILEAL RQAENEPPSALKENKPYALNLEKNFPVDTPDDYETQQWPERKLKHMRFPLMYEENSRENP FKRTNEIVEEQYTPQSLATLESVFQELGKLTGPSNQKRERVDEEQKLYTDDEDDVYKTNN IAYEDVVGGEDWSPMEEKIETQTQEEVRDSKENTEKNEQINEEMKRSGHLGLPDEGNRKE SKDQLSEDASKVITYLRRLVNAVGSGRSQSGQNGDRAARLLERPLDSQSIYQLIEISRNL QIPPEDLIEMLKAGEKPNGLVEPEQDLELAVDLDDIPEADIDRPDMFQSKTLSKGGYPKA PGRGMMEALPDGLSVEDILNVLGMENVANQKSPYFPNQYSRDKALLRLPYGPGKSRANQI PKVAWIPDVESRQAPYDNLNDKDQELGEYLARMLVKYPELMNTNQLKRVPSPGSSEDDLQ EEEQLEQAIKEHLGQGSSQEMEKLAKVSKRIPAGSLKNEDTPNRQYLDEDMLLKVLEYLN QEQAEQGREHLAKRAMENM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolScg2
Gene SynonymChcg
Chromosome9
Locus Map9q34
All Transcripts NM_022669
Title Manserin, a secretogranin II-derived peptide, distributes in the rat endocrine pancreas colocalized with islet-cell specific manner .
Author Tano,K., Oyabu,A., Tashiro,Y., Kamada,N., Narita,N., Nasu,F. and Narita,M.
Journal Histochem. Cell Biol. 134 (1), 53-57 (2010)
Title Pro-hormone secretogranin II regulates dense core secretory granule biogenesis in catecholaminergic cells .
Author Courel,M., Soler-Jover,A., Rodriguez-Flores,J.L., Mahata,S.K., Elias,S., Montero-Hadjadje,M., Anouar,Y., Giuly,R.J., O'Connor,D.T. and Taupenot,L.
Journal J. Biol. Chem. 285 (13), 10030-10043 (2010)
Title Sorting of the neuroendocrine secretory protein Secretogranin II into the regulated secretory pathway: role of N- and C-terminal alpha-helical domains .
Author Courel,M., Vasquez,M.S., Hook,V.Y., Mahata,S.K. and Taupenot,L.
Journal J. Biol. Chem. 283 (17), 11807-11822 (2008)
Title 3', 5'-cyclic adenosine 5'-monophosphate response element-dependent transcriptional regulation of the secretogranin II gene promoter depends on gonadotropin-releasing hormone-induced mitogen-activated protein kinase activation and the transactivator activating transcription factor 3 .
Author Xie,J. and Roberson,M.S.
Journal Endocrinology 149 (2), 783-792 (2008)
Title Manserin, a novel peptide from secretogranin II in the neuroendocrine system .
Author Yajima,A., Ikeda,M., Miyazaki,K., Maeshima,T., Narita,N. and Narita,M.
Journal Neuroreport 15 (11), 1755-1759 (2004)
Title Expression of chromogranin/secretogranin mRNA in spontaneous mammary tumors in aging Fischer-344 rats .
Author Umemura,S., Iwasaka,T. and Osamura,R.Y.
Journal Pathol. Int. 51 (9), 667-670 (2001)
Title Differential regulation of chromogranin A, chromogranin B and secretogranin II in rat brain by phencyclidine treatment .
Author Marksteiner,J., Weiss,U., Weis,C., Laslop,A., Fischer-Colbrie,R., Humpel,C., Feldon,J. and Fleischhacker,W.W.
Journal Neuroscience 104 (2), 325-333 (2001)
Title Formation and sequence analysis of secretoneurin, a neuropeptide derived from secretogranin II, in mammalian, bird, reptile, amphibian and fish brains .
Author Leitner,B., Schneitler,C., Klocker,H., Volknandt,W., Zimmermann,H., Winkler,H. and Fischer-Colbrie,R.
Journal Neurosci. Lett. 248 (2), 105-108 (1998)
Title Regulation of expression of secretogranin II mRNA in female rat pituitary and hypothalamus .
Author Kakar,S.S., Wei,N., Mulchahey,J.J., LeBoeuf,R.D. and Neill,J.D.
Journal Neuroendocrinology 57 (3), 422-431 (1993)
Title The primary structure of rat secretogranin II deduced from a cDNA sequence .
Author Gerdes,H.H., Phillips,E. and Huttner,W.B.
Journal Nucleic Acids Res. 16 (24), 11811 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878