• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_022970 Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_022970.3, 189083816
Length 4657 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant 2, mRNA.
Product fibroblast growth factor receptor 2 isoform 2 precursor
Comment

Summary: The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member is a high-affinity receptor for acidic, basic and/or keratinocyte growth factor, depending on the isoform. Mutations in this gene are associated with Crouzon syndrome, Pfeiffer syndrome, Craniosynostosis, Apert syndrome, Jackson-Weiss syndrome, Beare-Stevenson cutis gyrata syndrome, Saethre-Chotzen syndrome, and syndromic craniosynostosis. Multiple alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jan 2009].


Transcript Variant: This variant (2) uses an alternate internal in-frame coding exon compared to transcript variant 1, resulting in an isoform (2, also known as isoform K-sam-IIH1, IIIb, and BFR-1) with a different, 1 aa longer protein segment in the mid-region compared to isoform 1.


Sequence Note: A downstream AUG translation start codon is selected for this RefSeq based on the presence of a strong Kozak consensus signal, a strong community standard for the use of the downstream start codon, and on a higher probability of an N-terminal signal peptide being present in the resulting protein. The use of an alternative in-frame upstream AUG start codon would result in a protein that is 19 aa longer at the N-terminus. Translation from the annotated downstream start codon is likely to occur via leaky scanning and/or reinitiation.


CCDS Note: A downstream AUG translation start codon is selected for this CCDS representation based on a strong community standard for its use, and on a higher probability of a signal peptide being present in the protein N-terminus. The use of an alternative upstream AUG start codon would result in a protein that is 19 aa longer at the N-terminus. The upstream AUG has a weak Kozak signal while the downstream AUG has a strong Kozak signal. Due to leaky scanning by ribosomes, it is possible that some ribosomes may initiate translation from the downstream AUG codon while others start from the upstream AUG. The presence of multiple upstream ORFs suggests that a combination of leaky scanning and translational reinitiation may be necessary to achieve translation of the annotated ORF.

RefSeq NP_075259.4
CDS 648..3116
Misc Feature(1)531..533
Misc Feature(2)531..533
Misc Feature(3)591..593
Misc Feature(4)786..1019
Misc Feature(5)807..977
Misc Feature(6)1137..1391
Misc Feature(7)order(1143..1145,1149..1151,1155..1157)
Misc Feature(8)order(1146..1148,1167..1175,1179..1181)
Misc Feature(9)1164..1361
Misc Feature(10)1434..1718
Misc Feature(11)1458..1721
Misc Feature(12)order(1485..1487,1500..1508,1593..1598,1614..1616,
Misc Feature(13)2052..3053
Misc Feature(14)2091..2921
Misc Feature(15)order(2109..2123,2133..2135,2193..2195,2199..2201,
Misc Feature(16)order(2109..2123,2133..2135,2193..2195,2199..2201,
Misc Feature(17)order(2121..2123,2361..2363,2367..2369,2526..2528,
Misc Feature(18)order(2577..2597,2643..2654)
Exon (1)1..497
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Exon (2)498..756
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Exon (3)757..1023
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Exon (4)1024..1101
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Exon (5)1102..1271
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Exon (6)1272..1395
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Exon (7)1396..1586
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Exon (8)1587..1734
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Exon (9)1735..1937
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Exon (10)1938..2089
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Exon (11)2090..2211
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Exon (12)2212..2322
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Exon (13)2323..2513
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Exon (14)2514..2636
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Exon (15)2637..2707
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Exon (16)2708..2845
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Exon (17)2846..2951
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Exon (18)2952..4643
Gene:FGFR2
Gene Synonym:BBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Translation MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEV RCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYF MVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSI NHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSK YGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQSAWLTVLPK QQAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLT KRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRD KLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMK MIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMT FKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKK TTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEG HRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQY SPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
77+dbSNP:
77+c, tdbSNP:41301041
190+a, cdbSNP:41301043
290+c, tdbSNP:41301545
complement(330)-g, cdbSNP:41301547
351..352+, ccdbSNP:41301549
412+a, c, gdbSNP:1047111
complement(491)-t, cdbSNP:41258305
complement(573)-g, adbSNP:41287990
complement(574)-g, adbSNP:4647922
587+g, tdbSNP:3135721
complement(602)-t, cdbSNP:201606812
complement(663)-g, adbSNP:141724446
complement(664)-g, cdbSNP:3750819
complement(670)-c, adbSNP:147307031
complement(675)-g, cdbSNP:370122049
complement(680)-g, adbSNP:200562301
complement(681)-t, cdbSNP:143978938
complement(711)-g, adbSNP:377570596
complement(712)-t, cdbSNP:189010277
complement(747)-g, cdbSNP:373546701
complement(761)-dbSNP:
complement(761)-t, cdbSNP:370046872
complement(790)-t, gdbSNP:200700308
complement(797)-g, adbSNP:376622125
complement(805)-g, adbSNP:371358242
806+a, gdbSNP:1047102
complement(807)-g, adbSNP:151126801
complement(817)-g, adbSNP:56226109
complement(829)-t, cdbSNP:199575491
complement(843)-t, cdbSNP:148514974
complement(847)-g, adbSNP:145746586
complement(848)-g, adbSNP:200386134
complement(849)-t, cdbSNP:374996878
complement(852)-t, cdbSNP:371714070
complement(869)-t, cdbSNP:367962518
complement(898)-c, adbSNP:144714823
complement(910)-g, adbSNP:200369248
complement(935)-g, adbSNP:55806379
complement(936)-t, cdbSNP:372430349
941+a, gdbSNP:1047101
complement(953)-g, adbSNP:368662264
complement(1000)-c, adbSNP:139263005
complement(1015)-t, cdbSNP:375935265
complement(1046)-dbSNP:
complement(1046)-g, adbSNP:373155033
complement(1120)-dbSNP:
complement(1120)-t, cdbSNP:112880592
complement(1141)-t, cdbSNP:146244307
complement(1180)-t, cdbSNP:141796960
complement(1184)-g, adbSNP:139617492
complement(1190)-g, adbSNP:150598483
complement(1191)-c, adbSNP:200766273
complement(1198)-t, adbSNP:202212545
complement(1203)-t, cdbSNP:55977237
complement(1204)-t, cdbSNP:755793
complement(1215)-g, adbSNP:147987917
complement(1330)-dbSNP:
complement(1330)-t, adbSNP:146948953
complement(1333)-t, adbSNP:368224180
1343+a, gdbSNP:1047100
complement(1376)-t, cdbSNP:199890227
1402..1404+dbSNP:
1402..1404+cgc, tctdbSNP:281865420
1402..1403+cg, ttdbSNP:121918498
1403..1405+ctt, gccdbSNP:387907372
complement(1403)-t, cdbSNP:138769323
complement(1405)-g, cdbSNP:77543610
1406+g, tdbSNP:3135755
complement(1410)-g, adbSNP:149200230
complement(1412)-g, cdbSNP:200759234
complement(1436)-t, cdbSNP:138315382
1446+c, tdbSNP:121918505
complement(1457)-g, adbSNP:150488750
complement(1458)-t, cdbSNP:183250272
1464..1466+, gacdbSNP:121918503
complement(1466)-g, adbSNP:140427785
1513+a, cdbSNP:121918497
1515+c, g, tdbSNP:121918501
1517+c, g, tdbSNP:121918499
1521+a, gdbSNP:121918500
complement(1526)-g, adbSNP:55745510
complement(1555)-g, cdbSNP:374608214
complement(1557)-t, cdbSNP:370877537
complement(1563)-g, cdbSNP:199937788
1572+c, tdbSNP:4647921
1576+a, gdbSNP:121913475
1588+dbSNP:
1588+a, gdbSNP:3206759
1594+g, tdbSNP:1129324
complement(1596)-t, g, adbSNP:1143401
1609+a, cdbSNP:1129323
1610+g, tdbSNP:1129322
complement(1616)-t, cdbSNP:369682344
1618+a, tdbSNP:1129321
1620+a, cdbSNP:1129320
1628+a, gdbSNP:1143402
1637+a, gdbSNP:1129318
1645+a, cdbSNP:1047095
1649+c, tdbSNP:1047090
1663+c, tdbSNP:1047088
1664+a, gdbSNP:1047087
1672+g, tdbSNP:1065581
1681+a, cdbSNP:1047083
complement(1682)-g, adbSNP:187206427
1685+a, tdbSNP:1047082
1689+a, cdbSNP:1065582
1691+g, tdbSNP:1047078
1696+a, tdbSNP:1047077
1700+c, gdbSNP:1047076
1706+a, cdbSNP:1047074
1710+c, tdbSNP:1129316
1712+c, gdbSNP:1129314
complement(1714)-g, cdbSNP:377431543
1715+a, tdbSNP:1129313
1718+c, tdbSNP:1129312
complement(1736)-dbSNP:
complement(1736)-t, cdbSNP:151250769
complement(1753)-t, adbSNP:143645832
1765+c, gdbSNP:121913477
1774+a, gdbSNP:121913478
1791+g, tdbSNP:387906678
1794+c, tdbSNP:121913474
1822+g, tdbSNP:387906677
complement(1841)-t, cdbSNP:377132080
complement(1888)-g, adbSNP:372348666
complement(1889)-t, cdbSNP:147674677
complement(1952)-dbSNP:
complement(1952)-g, adbSNP:141297318
complement(1953)-t, cdbSNP:146589618
complement(1975)-t, gdbSNP:368002690
complement(1976)-g, adbSNP:184889995
complement(1977)-g, cdbSNP:7078073
complement(1979)-c, adbSNP:374423103
complement(1980)-g, adbSNP:143361368
complement(2011)-g, adbSNP:148672240
complement(2012)-t, cdbSNP:200183009
complement(2025)-t, adbSNP:370602437
complement(2032)-g, adbSNP:376451171
complement(2091)-dbSNP:
complement(2091)-g, adbSNP:144116729
complement(2105)-t, cdbSNP:149962204
complement(2160)-t, cdbSNP:370273049
complement(2183)-t, cdbSNP:138985383
complement(2189)-g, adbSNP:74160617
complement(2198)-t, cdbSNP:200522893
complement(2212)-dbSNP:
complement(2212)-t, cdbSNP:55689343
complement(2222)-t, cdbSNP:74160613
2226+a, gdbSNP:121918507
2297+a, tdbSNP:121913476
2344+dbSNP:
2344+a, cdbSNP:121918506
complement(2364)-g, adbSNP:371854567
complement(2396)-g, adbSNP:369850306
complement(2397)-t, cdbSNP:138712692
complement(2411)-g, adbSNP:147173572
complement(2424)-g, adbSNP:141929882
complement(2435)-t, cdbSNP:55724054
complement(2438)-t, cdbSNP:56335660
complement(2450)-g, adbSNP:375961106
complement(2468)-g, cdbSNP:371395564
complement(2510)-t, cdbSNP:143796403
complement(2516)-dbSNP:
complement(2516)-g, adbSNP:369637667
2532+a, gdbSNP:121918509
complement(2561)-g, adbSNP:149008039
complement(2580)-t, cdbSNP:138631412
complement(2591)-t, cdbSNP:35337478
2592+a, gdbSNP:121918508
complement(2640)-dbSNP:
complement(2640)-g, adbSNP:113014479
complement(2651)-g, cdbSNP:61731218
complement(2685)-t, cdbSNP:371596204
complement(2687)-t, cdbSNP:141253851
complement(2717)-dbSNP:
complement(2717)-g, adbSNP:369130429
complement(2728)-g, adbSNP:146571201
complement(2755)-g, adbSNP:150015885
complement(2774)-g, adbSNP:140813163
complement(2839)-t, cdbSNP:200453002
complement(2840)-g, adbSNP:55637244
complement(2881)-dbSNP:
complement(2881)-g, adbSNP:375719482
complement(2882)-g, adbSNP:142639988
complement(2888)-g, cdbSNP:116895810
complement(2926)-t, cdbSNP:55774317
2939+c, tdbSNP:41294229
complement(2958)-dbSNP:
complement(2958)-g, adbSNP:201752803
complement(2978)-g, adbSNP:148478597
complement(2979)-t, cdbSNP:374993905
complement(2996)-c, adbSNP:147439731
complement(3071)-t, cdbSNP:371712759
complement(3076)-g, adbSNP:368003279
complement(3099)-t, cdbSNP:144176428
complement(3107)-g, adbSNP:140318221
complement(3266)-t, gdbSNP:184026174
complement(3300)-t, cdbSNP:4647917
3374+a, tdbSNP:1047058
3375+c, tdbSNP:1047057
complement(3375)-g, adbSNP:386513156
3406+c, tdbSNP:3135824
3437+a, gdbSNP:3135825
complement(3440)-t, cdbSNP:150519853
complement(3501)-g, adbSNP:41294349
complement(3508..3509)-, tdbSNP:35819635
3519+a, gdbSNP:3135826
complement(3579)-t, cdbSNP:373313930
complement(3583)-t, gdbSNP:191969195
complement(3585)-g, adbSNP:41294351
3613+c, tdbSNP:3135827
complement(3763)-t, adbSNP:185913671
3853+c, gdbSNP:3135828
complement(3865..3866)-, cdbSNP:36087207
complement(3868..3869)-, gdbSNP:34055669
complement(3944)-t, cdbSNP:201270816
complement(3990)-t, cdbSNP:55723405
complement(3994..3995)-, tdbSNP:35899971
complement(4037)-t, cdbSNP:185617859
4041+c, tdbSNP:3135829
complement(4042)-t, cdbSNP:181383630
4076+c, tdbSNP:41294353
complement(4242)-g, adbSNP:370106008
complement(4256)-t, cdbSNP:189063367
complement(4370)-t, cdbSNP:367769355
complement(4417)-g, adbSNP:71640261
4435+a, gdbSNP:3135830
complement(4628)-t, cdbSNP:141765473
Gene SymbolFGFR2
Gene SynonymBBDS; BEK; BFR-1; CD332; CEK3; CFD1; ECT1; JWS; K-SAM; KGFR; TK14; TK25
Chromosome10
Locus Map10q26
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001144919 Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant 9, mRNA. On-demand $849.00 20
NM_023029 Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant 11, mRNA. On-demand $849.00 20
NM_001144913 Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant 3, mRNA. On-demand $899.00 20
NM_001144916 Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant 6, mRNA. On-demand $849.00 20
NM_000141 Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant 1, mRNA. In-stock $809.00 $760.00 15
NM_001144915 Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant 5, mRNA. On-demand $849.00 20
NM_001144917 Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant 7, mRNA. On-demand $849.00 20
NM_001144914 Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant 4, mRNA. On-demand $849.00 20
NM_001144918 Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant 8, mRNA. On-demand $849.00 20
NM_022970 Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant 2, mRNA. On-demand $899.00 20
XM_006717708 PREDICTED: Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant X1, mRNA. On-demand $899.00 20
XM_006717709 PREDICTED: Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant X2, mRNA. On-demand $899.00 20
XM_006717710 PREDICTED: Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant X3, mRNA. On-demand $899.00 20
XM_006717711 PREDICTED: Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant X4, mRNA. On-demand $849.00 20
XM_006717712 PREDICTED: Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant X5, mRNA. On-demand $849.00 20
XM_006717713 PREDICTED: Homo sapiens fibroblast growth factor receptor 2 (FGFR2), transcript variant X6, mRNA. On-demand $899.00 20
Title FGFR2 amplification has prognostic significance in gastric cancer: results from a large international multicentre study .
Author Su X, Zhan P, Gavine PR, Morgan S, Womack C, Ni X, Shen D, Bang YJ, Im SA, Ho Kim W, Jung EJ, Grabsch HI and Kilgour E.
Journal Br. J. Cancer 110 (4), 967-975 (2014)
Title Competition between Grb2 and Plcgamma1 for FGFR2 regulates basal phospholipase activity and invasion .
Author Timsah Z, Ahmed Z, Lin CC, Melo FA, Stagg LJ, Leonard PG, Jeyabal P, Berrout J, O'Neil RG, Bogdanov M and Ladbury JE.
Journal Nat. Struct. Mol. Biol. 21 (2), 180-188 (2014)
Title FGFR2, HER2 and cMet in gastric adenocarcinoma: detection, prognostic significance and assessment of downstream pathway activation .
Author Betts G, Valentine H, Pritchard S, Swindell R, Williams V, Morgan S, Griffiths EA, Welch I, West C and Womack C.
Journal Virchows Arch. 464 (2), 145-156 (2014)
Title Genome-wide association study of breast cancer in the Japanese population .
Author Low SK, Takahashi A, Ashikawa K, Inazawa J, Miki Y, Kubo M, Nakamura Y and Katagiri T.
Journal PLoS ONE 8 (10), E76463 (2013)
Title FGFR-Related Craniosynostosis Syndromes .
Author Robin,N.H., Falk,M.J. and Haldeman-Englert,C.R.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Congenital Diaphragmatic Hernia Overview .
Author Pober,B.R., Russell,M.K. and Ackerman,K.G.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title A novel form of fibroblast growth factor receptor 2. Alternative splicing of the third immunoglobulin-like domain confers ligand binding specificity .
Author Dell KR and Williams LT.
Journal J. Biol. Chem. 267 (29), 21225-21229 (1992)
Title Expression of basic fibroblast growth factor, FGFR1 and FGFR2 in normal and malignant human breast, and comparison with other normal tissues .
Author Luqmani YA, Graham M and Coombes RC.
Journal Br. J. Cancer 66 (2), 273-280 (1992)
Title K-sam gene encodes secreted as well as transmembrane receptor tyrosine kinase .
Author Katoh M, Hattori Y, Sasaki H, Tanaka M, Sugano K, Yazaki Y, Sugimura T and Terada M.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (7), 2960-2964 (1992)
Title Determination of ligand-binding specificity by alternative splicing: two distinct growth factor receptors encoded by a single gene .
Author Miki T, Bottaro DP, Fleming TP, Smith CL, Burgess WH, Chan AM and Aaronson SA.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (1), 246-250 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.