Homo sapiens zinc finger protein 649 (ZNF649), mRNA.
| RefSeq Version | NM_023074.3, 296531455 |
| Length | 3234 bp |
| Structure | linear |
| Update Date | 10-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens zinc finger protein 649 (ZNF649), mRNA. |
| Product | zinc finger protein 649 |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DA782250.1, AK315487.1, AC011460.3 and AL713677.1. On May 22, 2010 this sequence version replaced gi:21362077. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. COMPLETENESS: complete on the 3' end. |
| RefSeq | NP_075562.2 |
| CDS | 327..1844 | Exon (1) | 1..139 | Exon (2) | 1..139 | Exon (3) | 140..341 | Exon (4) | 342..468 | Exon (5) | 469..564 | Exon (6) | 565..3227 |
| Translation | MTKAQESLTLEDVAVDFTWEEWQFLSPAQKDLYRDVMLENYSNLVSVGYQAGKPDALTKL
EQGEPLWTLEDEIHSPAHPEIEKADDHLQQPLQNQKILKRTGQRYEHGRTLKSYLGLTNQ
SRRYNRKEPAEFNGDGAFLHDNHEQMPTEIEFPESRKPISTKSQFLKHQQTHNIEKAHEC
TDCGKAFLKKSQLTEHKRIHTGKKPHVCSLCGKAFYKKYRLTEHERAHRGEKPHGCSLCG
KAFYKRYRLTEHERAHKGEKPYGCSECGKAFPRKSELTEHQRIHTGIKPHQCSECGRAFS
RKSLLVVHQRTHTGEKPHTCSECGKGFIQKGNLNIHQRTHTGEKPYGCIDCGKAFSQKSC
LVAHQRYHTGKTPFVCPECGQPCSQKSGLIRHQKIHSGEKPYKCSDCGKAFLTKTMLIVH
HRTHTGERPYGCDECEKAYFYMSCLVKHKRIHSREKRGDSVKVENPSTASHSLSPSEHVQ
GKSPVNMVTVAMVAGQCEFAHILHS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(67..68) | - | , accggc | dbSNP:71861484 |
| complement(67) | - | t, c | dbSNP:116330073 |
| complement(70..71) | - | , ggcacc | dbSNP:72044364 |
| complement(72) | - | t, c | dbSNP:7258676 |
| complement(89) | - | c, a | dbSNP:7257759 |
| complement(90) | - | g, a | dbSNP:7257987 |
| complement(171) | - | t, c | dbSNP:1549931 |
| complement(286) | - | t, c | dbSNP:114365071 |
| complement(543) | - | t, g | dbSNP:79978148 |
| complement(665) | - | t, a | dbSNP:113773579 |
| complement(1381) | - | t, c | dbSNP:6509593 |
| complement(1622) | - | c, a | dbSNP:74803282 |
| complement(1695) | - | g, a | dbSNP:111793061 |
| complement(1716) | - | t, c | dbSNP:61731262 |
| complement(1731) | - | t, c | dbSNP:1433083 |
| complement(1742) | - | g, a | dbSNP:113984940 |
| complement(1752) | - | t, c | dbSNP:115110562 |
| complement(1879) | - | g, a | dbSNP:118021701 |
| complement(1974) | - | , aa | dbSNP:71713909 |
| complement(2108) | - | g, a | dbSNP:76386468 |
| complement(2389) | - | t, c | dbSNP:28608626 |
| complement(2562) | - | t, c | dbSNP:115360861 |
| complement(2565) | - | g, a | dbSNP:6509592 |
| complement(2632) | - | c, a | dbSNP:79885172 |
| 3079 | + | a, g | dbSNP:1125222 |
| Title | ZNF649, a novel Kruppel type zinc-finger protein, functions as a transcriptional suppressor . |
| Author | Yang,H., Yuan,W., Wang,Y., Zhu,C., Liu,B., Wang,Y., Yang,D., Li,Y., Wang,C., Wu,X. and Liu,M. |
| Journal | Biochem. Biophys. Res. Commun. 333 (1), 206-215 (2005) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |