• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens zinc finger protein 649 (ZNF649), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_023074 Homo sapiens zinc finger protein 649 (ZNF649), mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 TBD

*Business Day

Related Services

RefSeq Version NM_023074.3, 296531455
Length 3234 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens zinc finger protein 649 (ZNF649), mRNA.
Product zinc finger protein 649
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DA782250.1, AK315487.1, AC011460.3 and AL713677.1. On May 22, 2010 this sequence version replaced gi:21362077.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.


##Evidence-Data-START## Transcript exon combination :: AL713677.1, AK022706.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025098 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_075562.2
CDS 327..1844
Misc Feature(1)258..260
Misc Feature(2)348..530
Misc Feature(3)348..530
Misc Feature(4)348..464
Misc Feature(5)903..971
Misc Feature(6)1104..>1289
Misc Feature(7)1152..1229
Misc Feature(8)1239..1313
Misc Feature(9)1320..1397
Misc Feature(10)1491..1565
Exon (1)1..139
Gene:ZNF649
Gene Synonym:ZNF649
Exon (2)140..341
Gene:ZNF649
Gene Synonym:ZNF649
Exon (3)342..468
Gene:ZNF649
Gene Synonym:ZNF649
Exon (4)469..564
Gene:ZNF649
Gene Synonym:ZNF649
Exon (5)565..3227
Gene:ZNF649
Gene Synonym:ZNF649
Translation MTKAQESLTLEDVAVDFTWEEWQFLSPAQKDLYRDVMLENYSNLVSVGYQAGKPDALTKL EQGEPLWTLEDEIHSPAHPEIEKADDHLQQPLQNQKILKRTGQRYEHGRTLKSYLGLTNQ SRRYNRKEPAEFNGDGAFLHDNHEQMPTEIEFPESRKPISTKSQFLKHQQTHNIEKAHEC TDCGKAFLKKSQLTEHKRIHTGKKPHVCSLCGKAFYKKYRLTEHERAHRGEKPHGCSLCG KAFYKRYRLTEHERAHKGEKPYGCSECGKAFPRKSELTEHQRIHTGIKPHQCSECGRAFS RKSLLVVHQRTHTGEKPHTCSECGKGFIQKGNLNIHQRTHTGEKPYGCIDCGKAFSQKSC LVAHQRYHTGKTPFVCPECGQPCSQKSGLIRHQKIHSGEKPYKCSDCGKAFLTKTMLIVH HRTHTGERPYGCDECEKAYFYMSCLVKHKRIHSREKRGDSVKVENPSTASHSLSPSEHVQ GKSPVNMVTVAMVAGQCEFAHILHS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(44)-dbSNP:
complement(44)-g, adbSNP:143542398
complement(67..68)-, accggcdbSNP:71861484
complement(68..69)-, accggadbSNP:201494972
complement(70..71)-, ggcaccdbSNP:72044364
complement(71..72)-, ggcaccdbSNP:142375592
complement(72)-t, cdbSNP:7258676
complement(77..78)-, ggcactdbSNP:201351477
complement(89)-c, adbSNP:7257759
complement(90)-g, adbSNP:7257987
complement(171)-dbSNP:
complement(171)-t, cdbSNP:1549931
complement(286)-t, cdbSNP:114365071
complement(292)-g, adbSNP:199959359
complement(370)-dbSNP:
complement(370)-c, adbSNP:149586071
complement(446)-g, cdbSNP:201376905
complement(479)-dbSNP:
complement(479)-g, adbSNP:138019190
complement(494)-g, adbSNP:146944203
complement(537)-t, cdbSNP:149249779
complement(543)-t, gdbSNP:79978148
complement(565)-dbSNP:
complement(565)-t, cdbSNP:150082546
complement(629)-t, cdbSNP:140908786
complement(647)-g, adbSNP:200012694
complement(665)-t, adbSNP:113773579
complement(727)-t, cdbSNP:185293060
complement(755)-g, adbSNP:139654377
complement(761)-t, cdbSNP:138119962
complement(769)-g, adbSNP:145464081
complement(855)-t, cdbSNP:190173893
complement(898)-g, adbSNP:140316655
complement(920)-t, cdbSNP:201271797
complement(928)-g, cdbSNP:146823528
complement(958)-g, cdbSNP:202142881
complement(998)-g, adbSNP:143659118
complement(999..1000)-, tcdbSNP:149943001
complement(1028)-g, adbSNP:200369720
complement(1029)-t, cdbSNP:149160719
complement(1063)-t, cdbSNP:200081147
complement(1082)-g, adbSNP:145209390
complement(1101)-g, cdbSNP:149982418
complement(1114)-c, adbSNP:202043923
complement(1139)-g, cdbSNP:144001139
complement(1168)-t, gdbSNP:139430904
complement(1180)-g, adbSNP:139149269
complement(1198)-t, cdbSNP:147525408
complement(1202)-g, adbSNP:144823530
complement(1276)-g, adbSNP:146216141
complement(1325)-g, adbSNP:199637703
complement(1336)-t, cdbSNP:201651426
complement(1354)-t, cdbSNP:199736733
complement(1372)-c, adbSNP:140888185
complement(1381)-t, cdbSNP:6509593
complement(1385)-t, cdbSNP:141220947
complement(1391)-g, adbSNP:141689126
complement(1430)-g, adbSNP:148219907
complement(1543)-t, cdbSNP:143903347
complement(1563)-t, adbSNP:201373903
complement(1579)-g, adbSNP:149447174
complement(1622)-c, adbSNP:74803282
complement(1692)-t, cdbSNP:201723307
complement(1695)-g, adbSNP:111793061
complement(1708)-g, adbSNP:138132582
complement(1716)-t, cdbSNP:61731262
complement(1720)-t, cdbSNP:140349201
complement(1721)-g, adbSNP:202202193
complement(1727)-g, adbSNP:144803970
complement(1731)-t, cdbSNP:1433083
complement(1742)-g, adbSNP:113984940
complement(1752)-t, cdbSNP:115110562
complement(1770)-t, cdbSNP:142804984
complement(1811)-t, cdbSNP:181493783
complement(1840)-g, cdbSNP:148916026
complement(1863)-t, cdbSNP:189812601
complement(1879)-g, adbSNP:118021701
complement(1974)-, aadbSNP:71713909
complement(2108)-g, adbSNP:76386468
complement(2343..2344)-, atdbSNP:139980232
complement(2389)-t, cdbSNP:28608626
complement(2500)-g, cdbSNP:187014027
complement(2516)-g, adbSNP:149421297
complement(2540)-g, adbSNP:138955001
complement(2561)-g, adbSNP:147232408
complement(2562)-t, cdbSNP:115360861
complement(2565)-g, adbSNP:6509592
complement(2935)-g, cdbSNP:181850626
complement(3032)-c, adbSNP:143840606
complement(3079)-g, adbSNP:1125222
Gene SymbolZNF649
Gene SynonymZNF649
Chromosome19
Locus Map19q13.41
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_023074 Homo sapiens zinc finger protein 649 (ZNF649), mRNA. In-stock $509.00 $460.00 TBD
Title ZNF649, a novel Kruppel type zinc-finger protein, functions as a transcriptional suppressor .
Author Yang,H., Yuan,W., Wang,Y., Zhu,C., Liu,B., Wang,Y., Yang,D., Li,Y., Wang,C., Wu,X. and Liu,M.
Journal Biochem. Biophys. Res. Commun. 333 (1), 206-215 (2005)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.