• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu26680 Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu26680C Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 1, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_023110.2, 105990521
Length 2469 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 1, mRNA.
Product fibroblast growth factor receptor 1 isoform 1 precursor
Comment

Summary: The protein encoded by this gene is a member of the fibroblast growth factor receptor (FGFR) family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds both acidic and basic fibroblast growth factors and is involved in limb induction. Mutations in this gene have been associated with Pfeiffer syndrome, Jackson-Weiss syndrome, Antley-Bixler syndrome, osteoglophonic dysplasia, and autosomal dominant Kallmann syndrome 2. Chromosomal aberrations involving this gene are associated with stem cell myeloproliferative disorder and stem cell leukemia lymphoma syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1), also known as isoform Alpha A1, IV and the 3-Ig domain+2 AA insert form.

RefSeq NP_075598.2
CDS 943..3411
Misc Feature(1)409..411
Misc Feature(2)1060..1296
Misc Feature(3)1081..1266
Misc Feature(4)1420..1683
Misc Feature(5)1420..1473
Misc Feature(6)1429..1683
Misc Feature(7)order(1435..1437,1441..1443,1447..1449)
Misc Feature(8)order(1438..1440,1459..1467,1471..1473)
Misc Feature(9)1726..2016
Misc Feature(10)1750..2019
Misc Feature(11)order(1777..1779,1792..1800,1885..1890,1900..1902,
Misc Feature(12)2071..2133
Misc Feature(13)2224..2229
Misc Feature(14)2317..3237
Misc Feature(15)2329..2331
Misc Feature(16)2374..3204
Misc Feature(17)order(2392..2406,2416..2418,2476..2478,2482..2484,
Misc Feature(18)order(2392..2397,2407..2409,2476..2478,2575..2577,
Misc Feature(19)2689..2691
Misc Feature(20)2695..2697
Misc Feature(21)order(2809..2811,2821..2823,2917..2931,2956..2958,
Misc Feature(22)2860..2937
Misc Feature(23)2899..2901
Misc Feature(24)2899..2901
Misc Feature(25)2902..2904
Misc Feature(26)3130..3132
Misc Feature(27)3238..3240
Misc Feature(28)3238..3240
Exon (1)1..854
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Exon (2)855..1033
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Exon (3)1034..1300
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Exon (4)1301..1390
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Exon (5)1391..1563
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Exon (6)1564..1687
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Exon (7)1688..1878
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Exon (8)1879..2023
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Exon (9)2024..2226
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Exon (10)2227..2372
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Exon (11)2373..2494
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Exon (12)2495..2605
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Exon (13)2606..2796
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Exon (14)2797..2919
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Exon (15)2920..2990
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Exon (16)2991..3128
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Exon (17)3129..3234
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Exon (18)3235..5901
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Translation MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD VQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSD ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKS IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSF PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(62)-dbSNP:
complement(62)-g, adbSNP:17182051
complement(81)-g, adbSNP:373494172
180+a, gdbSNP:17182058
complement(192)-g, adbSNP:2445003
complement(244)-g, adbSNP:328307
complement(307)-g, adbSNP:3213849
complement(369)-g, adbSNP:369756901
complement(491)-t, cdbSNP:376511681
complement(558)-g, adbSNP:2467531
585+c, tdbSNP:17175673
657+c, tdbSNP:4647909
784+, gdbSNP:4647908
819+a, gdbSNP:17182079
complement(907)-dbSNP:
complement(907)-t, cdbSNP:200766494
complement(922)-t, adbSNP:376018211
complement(928)-t, cdbSNP:371654310
complement(975)-g, adbSNP:202034569
complement(989)-g, adbSNP:200596591
complement(996)-g, adbSNP:35494097
complement(1006)-t, cdbSNP:148343099
1008+c, gdbSNP:17175750
complement(1010)-g, adbSNP:143341876
complement(1011)-t, cdbSNP:369704492
complement(1016)-g, adbSNP:149206728
complement(1017)-g, adbSNP:17175757
complement(1025)-g, adbSNP:145434725
complement(1054)-dbSNP:
complement(1054)-t, cdbSNP:377555354
1084+a, gdbSNP:121909640
complement(1103)-t, cdbSNP:145315779
complement(1110)-t, cdbSNP:147482922
complement(1115)-t, cdbSNP:200116660
complement(1116)-t, cdbSNP:144723622
complement(1118)-t, adbSNP:150042321
complement(1119)-g, adbSNP:367880371
complement(1136)-t, cdbSNP:375271913
complement(1149)-g, adbSNP:145220136
complement(1150)-t, cdbSNP:140254426
complement(1163)-g, adbSNP:143241978
complement(1172..1173)-, gdbSNP:141676608
complement(1181)-t, cdbSNP:201055054
complement(1183)-t, cdbSNP:201574031
complement(1204)-c, adbSNP:139867599
complement(1215)-g, adbSNP:201823433
complement(1219)-g, adbSNP:372511659
complement(1223)-t, gdbSNP:150973404
complement(1245)-g, adbSNP:142638017
complement(1246)-t, cdbSNP:55642501
complement(1262)-g, adbSNP:140382957
complement(1263)-t, cdbSNP:200846866
complement(1278)-g, adbSNP:148480919
1287+c, tdbSNP:2915665
1316+dbSNP:
1316+c, tdbSNP:121913473
1317+a, gdbSNP:17182296
complement(1317)-g, adbSNP:386542900
complement(1325)-t, gdbSNP:77734798
complement(1338..1340)-, tcadbSNP:138489552
complement(1347)-g, adbSNP:374139613
complement(1357)-t, cdbSNP:201054877
complement(1364)-g, cdbSNP:200482627
complement(1398)-dbSNP:
complement(1398)-g, adbSNP:369175953
complement(1413)-g, adbSNP:376497452
1436+c, tdbSNP:397515481
1441+g, tdbSNP:121909630
complement(1449)-t, cdbSNP:374145904
complement(1542)-t, cdbSNP:17175898
complement(1579)-dbSNP:
complement(1579)-c, adbSNP:17851623
complement(1587)-g, adbSNP:141651612
complement(1620)-g, adbSNP:375972092
complement(1650)-g, adbSNP:373644620
1651+a, gdbSNP:121909635
complement(1684)-t, cdbSNP:186746130
1691+dbSNP:
1691+a, gdbSNP:121909645
1696+a, cdbSNP:121913472
1697+c, gdbSNP:121909627
1704+c, gdbSNP:1126484
1725+c, gdbSNP:4647901
complement(1791)-t, cdbSNP:374583846
1841+c, tdbSNP:121909633
complement(1863)-g, adbSNP:377010221
1865+c, tdbSNP:1126485
1931+dbSNP:
1931+a, tdbSNP:121909632
1967+c, tdbSNP:121909638
complement(2001)-g, adbSNP:145404644
complement(2034)-dbSNP:
complement(2034)-t, cdbSNP:375307033
2039+c, tdbSNP:121909641
complement(2040)-t, cdbSNP:56174879
complement(2056)-g, adbSNP:377648976
2063+a, gdbSNP:121909631
complement(2078)-g, adbSNP:374135854
2083+c, tdbSNP:121909634
complement(2105)-g, adbSNP:370205081
complement(2110)-t, cdbSNP:376921992
complement(2113)-t, cdbSNP:202073071
complement(2118)-t, cdbSNP:56273573
complement(2120)-g, adbSNP:369059499
complement(2121)-t, cdbSNP:374674165
complement(2166)-g, cdbSNP:369529821
complement(2211)-t, cdbSNP:144131616
complement(2212)-g, adbSNP:369096310
complement(2213)-t, cdbSNP:183376882
complement(2242)-dbSNP:
complement(2242)-t, cdbSNP:375914079
complement(2261)-t, cdbSNP:372654433
complement(2276)-t, cdbSNP:367715495
complement(2294)-g, cdbSNP:374672119
complement(2310)-c, adbSNP:200776757
complement(2327)-t, cdbSNP:367955950
complement(2328)-t, cdbSNP:375796487
complement(2340)-g, adbSNP:150652786
2351+g, tdbSNP:121909637
complement(2367)-t, cdbSNP:377292915
2389+dbSNP:
2389+a, cdbSNP:397515444
complement(2451)-g, cdbSNP:372521005
complement(2462)-t, cdbSNP:369356672
complement(2475)-g, cdbSNP:374922798
complement(2480)-c, adbSNP:77988343
complement(2482)-t, cdbSNP:199573818
complement(2496)-dbSNP:
complement(2496)-t, cdbSNP:199499923
complement(2557)-t, cdbSNP:201158796
complement(2751)-dbSNP:
complement(2751)-g, adbSNP:377314381
complement(2757)-g, adbSNP:374740971
2761+a, gdbSNP:121909629
2767+c, tdbSNP:121909639
complement(2778)-t, cdbSNP:371019935
2806+dbSNP:
2806+c, tdbSNP:121909628
2809+g, tdbSNP:398122946
complement(2895)-g, adbSNP:376421301
2950+dbSNP:
2950+a, gdbSNP:397515446
complement(2965)-g, adbSNP:375611478
2980+c, tdbSNP:121909636
3017+a, gdbSNP:397515445
complement(3105)-t, cdbSNP:375706099
3106+c, tdbSNP:121909642
3107+a, cdbSNP:267606805
3114+c, gdbSNP:267606806
3116+a, gdbSNP:398122945
complement(3204)-dbSNP:
complement(3204)-t, cdbSNP:56341011
complement(3209)-t, cdbSNP:374473310
complement(3213)-g, adbSNP:369782405
complement(3219)-g, cdbSNP:369776263
complement(3220)-g, adbSNP:201490643
3234+g, tdbSNP:121909643
complement(3240)-dbSNP:
complement(3240)-g, adbSNP:376173540
complement(3242)-c, adbSNP:149979921
3244+g, tdbSNP:121909644
complement(3247)-g, cdbSNP:2956723
complement(3256)-g, adbSNP:56234888
complement(3285)-g, adbSNP:370615877
complement(3292)-g, adbSNP:377149398
complement(3300)-g, adbSNP:55906164
complement(3303)-t, cdbSNP:200408837
complement(3324)-g, adbSNP:369652756
complement(3341)-g, adbSNP:377620009
complement(3366)-g, cdbSNP:374507681
3394+a, gdbSNP:17182456
3406+c, tdbSNP:17182463
complement(3413)-c, adbSNP:375101187
complement(3425)-t, cdbSNP:371776128
complement(3444)-t, cdbSNP:369397371
complement(3524)-t, cdbSNP:180885042
complement(3539)-c, adbSNP:7008573
complement(3631)-g, adbSNP:138421779
complement(3676)-g, adbSNP:371914691
complement(3761)-g, adbSNP:147453318
complement(3935)-g, adbSNP:11548610
complement(3980)-t, cdbSNP:17182470
complement(3980)-t, cdbSNP:386542904
complement(3981)-t, adbSNP:188117153
complement(4031)-g, adbSNP:184963408
4134+c, gdbSNP:17182477
complement(4136)-t, cdbSNP:386545659
4136+c, tdbSNP:1803197
4171+a, tdbSNP:17176074
complement(4317)-t, adbSNP:139347382
4405+c, tdbSNP:17176081
complement(4412)-t, cdbSNP:181986208
4463+c, tdbSNP:17176088
complement(4464)-t, cdbSNP:190347151
complement(4622)-c, adbSNP:185104092
4700+a, gdbSNP:17176095
complement(4700)-g, adbSNP:386542870
complement(4772)-g, cdbSNP:192990547
complement(4813)-t, adbSNP:187998244
complement(4850)-g, adbSNP:11990198
complement(4901)-t, cdbSNP:368120271
4909+c, tdbSNP:17182484
complement(4990)-t, cdbSNP:191345081
complement(5043)-t, cdbSNP:13317
complement(5107)-t, cdbSNP:186562285
complement(5181)-t, cdbSNP:183394116
complement(5218..5219)-, cdbSNP:35229167
complement(5310)-g, cdbSNP:191921266
complement(5443)-g, adbSNP:188827615
complement(5447..5448)-, acdbSNP:369476203
complement(5452)-t, cdbSNP:183426730
complement(5483)-g, cdbSNP:143775607
complement(5510)-c, adbSNP:16887356
complement(5515)-, tdbSNP:201364530
complement(5528..5529)-, gadbSNP:372106811
complement(5566)-c, adbSNP:371446312
complement(5598)-t, cdbSNP:367681874
5599+a, gdbSNP:146463691
5629+a, tdbSNP:145228103
complement(5685..5686)-, ctdbSNP:375003683
5688+g, tdbSNP:1046400
complement(5712)-t, gdbSNP:117104905
complement(5781)-t, cdbSNP:191631744
complement(5802)-t, cdbSNP:185729862
Gene SymbolFGFR1
Gene SynonymbFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; HRTFDS; KAL2; N-SAM; OGD
Chromosome8
Locus Map8p11.23-p11.22
Title FGFR1-WNT-TGF-beta signaling in prostate cancer mouse models recapitulates human reactive stroma .
Author Carstens JL, Shahi P, Van Tsang S, Smith B, Creighton CJ, Zhang Y, Seamans A, Seethammagari M, Vedula I, Levitt JM, Ittmann MM, Rowley
Journal Cancer Res. 74 (2), 609-620 (2014)
Title Structural insights into the interaction of human S100B and basic fibroblast growth factor (FGF2): Effects on FGFR1 receptor signaling .
Author Gupta AA, Chou RH, Li H, Yang LW and Yu C.
Journal Biochim. Biophys. Acta 1834 (12), 2606-2619 (2013)
Title Dynamic modulation of FGFR1-5-HT1A heteroreceptor complexes. Agonist treatment enhances participation of FGFR1 and 5-HT1A homodimers and recruitment of beta-arrestin2 .
Author Borroto-Escuela DO, Corrales F, Narvaez M, Oflijan J, Agnati LF, Palkovits M and Fuxe K.
Journal Biochem. Biophys. Res. Commun. 441 (2), 387-392 (2013)
Title Prognostic value of fibroblast growth factor receptor 1 gene locus amplification in resected lung squamous cell carcinoma .
Author Craddock KJ, Ludkovski O, Sykes J, Shepherd FA and Tsao MS.
Journal J Thorac Oncol 8 (11), 1371-1377 (2013)
Title FGFR-Related Craniosynostosis Syndromes .
Author Robin,N.H., Falk,M.J. and Haldeman-Englert,C.R.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Isolated Gonadotropin-Releasing Hormone (GnRH) Deficiency .
Author Buck,C., Balasubramanian,R. and Crowley,W.F.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Point mutation in FGF receptor eliminates phosphatidylinositol hydrolysis without affecting mitogenesis .
Author Mohammadi M, Dionne CA, Li W, Li N, Spivak T, Honegger AM, Jaye M and Schlessinger J.
Journal Nature 358 (6388), 681-684 (1992)
Title Point mutation of an FGF receptor abolishes phosphatidylinositol turnover and Ca2+ flux but not mitogenesis .
Author Peters KG, Marie J, Wilson E, Ives HE, Escobedo J, Del Rosario M, Mirda D and Williams LT.
Journal Nature 358 (6388), 678-681 (1992)
Title Expression of basic fibroblast growth factor, FGFR1 and FGFR2 in normal and malignant human breast, and comparison with other normal tissues .
Author Luqmani YA, Graham M and Coombes RC.
Journal Br. J. Cancer 66 (2), 273-280 (1992)
Title K-sam-related gene, N-sam, encodes fibroblast growth factor receptor and is expressed in T-lymphocytic tumors .
Author Hattori Y, Odagiri H, Katoh O, Sakamoto H, Morita T, Shimotohno K, Tobinai K, Sugimura T and Terada M.
Journal Cancer Res. 52 (12), 3367-3371 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.