• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_023110 Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 1, mRNA. ORF Sequence $716.01
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_023110.2, 105990521
Length 5917 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 1, mRNA.
Product fibroblast growth factor receptor 1 isoform 1 precursor
Comment

Summary: The protein encoded by this gene is a member of the fibroblast growth factor receptor (FGFR) family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds both acidic and basic fibroblast growth factors and is involved in limb induction. Mutations in this gene have been associated with Pfeiffer syndrome, Jackson-Weiss syndrome, Antley-Bixler syndrome, osteoglophonic dysplasia, and autosomal dominant Kallmann syndrome 2. Chromosomal aberrations involving this gene are associated with stem cell myeloproliferative disorder and stem cell leukemia lymphoma syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1), also known as isoform Alpha A1, IV and the 3-Ig domain+2 AA insert form.

RefSeq NP_075598.2
CDS 943..3411
Misc Feature(1)409..411
Misc Feature(2)1060..1296
Misc Feature(3)1420..1683
Misc Feature(4)1420..1473
Misc Feature(5)1429..1683
Misc Feature(6)order(1435..1437,1441..1443,1447..1449)
Misc Feature(7)order(1438..1440,1459..1467,1471..1473)
Misc Feature(8)1726..2016
Misc Feature(9)1750..2019
Misc Feature(10)order(1777..1779,1792..1800,1885..1890,1900..1902,
Misc Feature(11)2071..2133
Misc Feature(12)2224..2229
Misc Feature(13)2317..3237
Misc Feature(14)2329..2331
Misc Feature(15)2374..3204
Misc Feature(16)order(2392..2406,2416..2418,2476..2478,2482..2484,
Misc Feature(17)order(2392..2397,2407..2409,2476..2478,2575..2577,
Misc Feature(18)2689..2691
Misc Feature(19)2695..2697
Misc Feature(20)order(2809..2811,2821..2823,2917..2931,2956..2958,
Misc Feature(21)2860..2937
Misc Feature(22)2899..2901
Misc Feature(23)2899..2901
Misc Feature(24)2902..2904
Misc Feature(25)3130..3132
Misc Feature(26)3238..3240
Misc Feature(27)3238..3240
Exon (1)1..854
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Exon (2)855..1033
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Exon (3)1034..1300
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Exon (4)1301..1390
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Exon (5)1391..1563
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Exon (6)1564..1687
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Exon (7)1688..1878
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Exon (8)1879..2023
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Exon (9)2024..2226
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Exon (10)2227..2372
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Exon (11)2373..2494
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Exon (12)2495..2605
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Exon (13)2606..2796
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Exon (14)2797..2919
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Exon (15)2920..2990
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Exon (16)2991..3128
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Exon (17)3129..3234
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Exon (18)3235..5901
Gene:FGFR1
Gene Synonym:bFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Translation MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD VQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSD ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKS IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSF PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(62)-dbSNP:
complement(62)-g, adbSNP:17182051
complement(180)-g, adbSNP:17182058
complement(192)-g, adbSNP:2445003
complement(244)-g, adbSNP:328307
complement(307..308)-, g, cdbSNP:5891031
complement(307)-g, adbSNP:3213849
complement(558)-g, adbSNP:2467531
complement(585)-t, cdbSNP:17175673
complement(657)-t, cdbSNP:4647909
complement(784)-, gdbSNP:4647908
complement(819)-g, adbSNP:17182079
complement(907)-dbSNP:
complement(907)-t, cdbSNP:200766494
complement(975)-g, adbSNP:202034569
complement(989)-g, adbSNP:200596591
complement(996)-g, adbSNP:35494097
complement(1006)-t, cdbSNP:148343099
complement(1008)-g, cdbSNP:17175750
complement(1010)-g, adbSNP:143341876
complement(1016)-g, adbSNP:149206728
complement(1017)-g, adbSNP:17175757
complement(1025)-g, adbSNP:145434725
complement(1036)-dbSNP:
complement(1036)-, gdbSNP:66493519
complement(1084)-g, adbSNP:121909640
complement(1103)-t, cdbSNP:145315779
complement(1110)-t, cdbSNP:147482922
complement(1115)-t, cdbSNP:200116660
complement(1116)-t, cdbSNP:144723622
complement(1118)-t, adbSNP:150042321
complement(1149)-g, adbSNP:145220136
complement(1150)-t, cdbSNP:140254426
complement(1153)-c, adbSNP:146670848
complement(1163)-g, adbSNP:143241978
complement(1171..1172)-, tdbSNP:66994496
complement(1173..1174)-, gdbSNP:141676608
complement(1181)-t, cdbSNP:201055054
complement(1183)-t, cdbSNP:201574031
complement(1204)-c, adbSNP:139867599
complement(1215)-g, adbSNP:201823433
complement(1223)-t, gdbSNP:150973404
complement(1245)-g, adbSNP:142638017
complement(1246)-t, cdbSNP:55642501
complement(1262)-g, adbSNP:140382957
complement(1263)-t, cdbSNP:200846866
complement(1278)-g, adbSNP:148480919
complement(1287)-t, cdbSNP:2915665
complement(1317)-dbSNP:
complement(1317)-g, adbSNP:17182296
complement(1325)-t, gdbSNP:77734798
complement(1338..1340)-, tcadbSNP:138489552
complement(1357)-t, cdbSNP:201054877
complement(1364)-g, cdbSNP:200482627
complement(1441)-dbSNP:
complement(1441)-t, gdbSNP:121909630
complement(1542)-t, cdbSNP:17175898
complement(1579)-dbSNP:
complement(1579)-c, adbSNP:17851623
complement(1587)-g, adbSNP:141651612
complement(1651)-g, adbSNP:121909635
complement(1684)-t, cdbSNP:186746130
complement(1691)-dbSNP:
complement(1691)-g, adbSNP:121909645
complement(1697)-g, cdbSNP:121909627
complement(1704)-g, cdbSNP:1126484
complement(1725)-g, cdbSNP:4647901
complement(1841)-t, cdbSNP:121909633
complement(1865)-t, cdbSNP:1126485
complement(1931)-dbSNP:
complement(1931)-t, adbSNP:121909632
complement(1967)-t, cdbSNP:121909638
complement(2001)-g, adbSNP:145404644
complement(2039)-dbSNP:
complement(2039)-t, cdbSNP:121909641
complement(2040)-t, cdbSNP:56174879
complement(2063)-g, adbSNP:121909631
2083+c, tdbSNP:121909634
complement(2113)-t, cdbSNP:202073071
complement(2118)-t, cdbSNP:56273573
complement(2211)-t, cdbSNP:144131616
complement(2213)-t, cdbSNP:183376882
complement(2310)-dbSNP:
complement(2310)-c, adbSNP:200776757
complement(2340)-g, adbSNP:150652786
complement(2351)-t, gdbSNP:121909637
complement(2480)-dbSNP:
complement(2480)-c, adbSNP:77988343
complement(2482)-t, cdbSNP:199573818
complement(2496)-dbSNP:
complement(2496)-t, cdbSNP:199499923
complement(2557)-t, cdbSNP:201158796
complement(2761)-dbSNP:
complement(2761)-g, adbSNP:121909629
complement(2767)-t, cdbSNP:121909639
complement(2806)-dbSNP:
complement(2806)-t, cdbSNP:121909628
complement(2880..2881)-, cdbSNP:67268517
complement(2980)-dbSNP:
complement(2980)-t, cdbSNP:121909636
complement(3106)-t, cdbSNP:121909642
3107+a, cdbSNP:267606805
3114+c, gdbSNP:267606806
complement(3204)-dbSNP:
complement(3204)-t, cdbSNP:56341011
complement(3220)-g, adbSNP:201490643
complement(3234)-t, gdbSNP:121909643
complement(3242)-dbSNP:
complement(3242)-c, adbSNP:149979921
complement(3244)-t, gdbSNP:121909644
complement(3247)-g, cdbSNP:2956723
complement(3256)-g, adbSNP:56234888
complement(3300)-g, adbSNP:55906164
complement(3303)-t, cdbSNP:200408837
complement(3394)-g, adbSNP:17182456
complement(3406)-t, cdbSNP:17182463
complement(3524)-t, cdbSNP:180885042
complement(3539)-c, adbSNP:7008573
complement(3631)-g, adbSNP:138421779
complement(3761)-g, adbSNP:147453318
complement(3820..3821)-, gcdbSNP:71684870
complement(3935)-g, adbSNP:11548610
complement(3980)-t, cdbSNP:17182470
complement(3981)-t, adbSNP:188117153
complement(4031)-g, adbSNP:184963408
complement(4134)-g, cdbSNP:17182477
complement(4136)-t, cdbSNP:1803197
complement(4171)-t, adbSNP:17176074
complement(4317)-t, adbSNP:139347382
complement(4405)-t, cdbSNP:17176081
complement(4412)-t, cdbSNP:181986208
complement(4463)-t, cdbSNP:17176088
complement(4464)-t, cdbSNP:190347151
complement(4622)-c, adbSNP:185104092
complement(4700)-g, adbSNP:17176095
complement(4772)-g, cdbSNP:192990547
complement(4813)-t, adbSNP:187998244
complement(4850)-g, adbSNP:11990198
complement(4909)-t, cdbSNP:17182484
complement(4990)-t, cdbSNP:191345081
complement(5043)-t, cdbSNP:13317
complement(5107)-t, cdbSNP:186562285
complement(5181)-t, cdbSNP:183394116
complement(5218..5219)-, cdbSNP:35229167
complement(5310)-g, cdbSNP:191921266
complement(5443)-g, adbSNP:188827615
complement(5452)-t, cdbSNP:183426730
complement(5483)-g, cdbSNP:143775607
complement(5510)-c, adbSNP:16887356
complement(5515)-, tdbSNP:201364530
complement(5599)-g, adbSNP:146463691
complement(5613..5614)-, gdbSNP:5891025
complement(5629)-t, adbSNP:145228103
complement(5688)-t, gdbSNP:1046400
complement(5712)-t, gdbSNP:117104905
complement(5781)-t, cdbSNP:191631744
complement(5802)-t, cdbSNP:185729862
Gene SymbolFGFR1
Gene SynonymbFGF-R-1; BFGFR; CD331; CEK; FGFBR; FGFR-1; FLG; FLT-2; FLT2; HBGFR; HH2; KAL2; N-SAM; OGD
Chromosome8
Locus Map8p12
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001174063 Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 10, mRNA. Full Length $2652.75
ORF Sequence $714.27
NM_001174064 Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 11, mRNA. Full Length $2683.35
ORF Sequence $707.31
NM_001174065 Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 12, mRNA. Full Length $2346.75
ORF Sequence $714.27
NM_001174066 Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 13, mRNA. Full Length $1733.90
ORF Sequence $638.58
NM_001174067 Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 14, mRNA. Full Length $2418.75
ORF Sequence $742.98
NM_015850 Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 2, mRNA. Full Length $2659.95
ORF Sequence $714.27
NM_023105 Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 3, mRNA. Full Length $2542.50
ORF Sequence $638.58
NM_023106 Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 4, mRNA. Full Length $2539.80
ORF Sequence $636.84
NM_023110 Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 1, mRNA. Full Length $2662.65
ORF Sequence $716.01
Title Fibroblast growth factor receptor 1 gene amplification is associated with poor survival and cigarette smoking dosage in patients with resected squamous cell lung cancer .
Author Kim,H.R., Kim,D.J., Kang,D.R., Lee,J.G., Lim,S.M., Lee,C.Y., Rha,S.Y., Bae,M.K., Lee,Y.J., Kim,S.H., Ha,S.J., Soo,R.A., Chung,K.Y., Kim,J.H., Lee,J.H., Shim,H.S. and Cho,B.C.
Journal J. Clin. Oncol. 31 (6), 731-737 (2013)
Title FGF-2 disrupts mitotic stability in prostate cancer through the intracellular trafficking protein CEP57 .
Author Cuevas,R., Korzeniewski,N., Tolstov,Y., Hohenfellner,M. and Duensing,S.
Journal Cancer Res. 73 (4), 1400-1410 (2013)
Title A case of 8p11 myeloproliferative syndrome with BCR-FGFR1 gene fusion presenting with trilineage acute leukemia/lymphoma, successfully treated by cord blood transplantation .
Author Morishige,S., Oku,E., Takata,Y., Kimura,Y., Arakawa,F., Seki,R., Imamura,R., Osaki,K., Hashiguchi,M., Yakushiji,K., Mizuno,S., Yoshimoto,K., Nagafuji,K., Ohshima,K. and Okamura,T.
Journal Acta Haematol. 129 (2), 83-89 (2013)
Title Nectin-1 binds and signals through the fibroblast growth factor receptor .
Author Bojesen,K.B., Clausen,O., Rohde,K., Christensen,C., Zhang,L., Li,S., Kohler,L., Nielbo,S., Nielsen,J., Gjorlund,M.D., Poulsen,F.M., Bock,E. and Berezin,V.
Journal J. Biol. Chem. 287 (44), 37420-37433 (2012)
Title Fibroblast growth factor receptor 1 activation in mammary tumor cells promotes macrophage recruitment in a CX3CL1-dependent manner .
Author Reed,J.R., Stone,M.D., Beadnell,T.C., Ryu,Y., Griffin,T.J. and Schwertfeger,K.L.
Journal PLoS ONE 7 (9), E45877 (2012)
Title Point mutation in FGF receptor eliminates phosphatidylinositol hydrolysis without affecting mitogenesis .
Author Mohammadi,M., Dionne,C.A., Li,W., Li,N., Spivak,T., Honegger,A.M., Jaye,M. and Schlessinger,J.
Journal Nature 358 (6388), 681-684 (1992)
Title Point mutation of an FGF receptor abolishes phosphatidylinositol turnover and Ca2+ flux but not mitogenesis .
Author Peters,K.G., Marie,J., Wilson,E., Ives,H.E., Escobedo,J., Del Rosario,M., Mirda,D. and Williams,L.T.
Journal Nature 358 (6388), 678-681 (1992)
Title Expression of basic fibroblast growth factor, FGFR1 and FGFR2 in normal and malignant human breast, and comparison with other normal tissues .
Author Luqmani,Y.A., Graham,M. and Coombes,R.C.
Journal Br. J. Cancer 66 (2), 273-280 (1992)
Title K-sam-related gene, N-sam, encodes fibroblast growth factor receptor and is expressed in T-lymphocytic tumors .
Author Hattori,Y., Odagiri,H., Katoh,O., Sakamoto,H., Morita,T., Shimotohno,K., Tobinai,K., Sugimura,T. and Terada,M.
Journal Cancer Res. 52 (12), 3367-3371 (1992)
Title Alternative splicing generates at least five different isoforms of the human basic-FGF receptor .
Author Eisemann,A., Ahn,J.A., Graziani,G., Tronick,S.R. and Ron,D.
Journal Oncogene 6 (7), 1195-1202 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878