• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fukutin related protein (FKRP), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu16480 Homo sapiens fukutin related protein (FKRP), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu16480C Homo sapiens fukutin related protein (FKRP), transcript variant 1, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_024301.4, 209574323
Length 1488 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens fukutin related protein (FKRP), transcript variant 1, mRNA.
Product fukutin-related protein
Comment

Summary: This gene encodes a protein which is targeted to the medial Golgi apparatus and is necessary for posttranslational modification of dystroglycan. Mutations in this gene have been associated with congenital muscular dystrophy, mental retardation, and cerebellar cysts. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Oct 2008].


Transcript Variant: This variant (1) differs in the 5' UTR compared to variant 1. Variants 1 and 2 encode the same protein.

RefSeq NP_077277.1
CDS 298..1785
Misc Feature(1)229..231
Misc Feature(2)316..384
Misc Feature(3)316..384
Misc Feature(4)1297..1719
Exon (1)1..45
Gene:FKRP
Gene Synonym:LGMD2I; MDC1C; MDDGA5; MDDGB5; MDDGC5
Exon (2)46..107
Gene:FKRP
Gene Synonym:LGMD2I; MDC1C; MDDGA5; MDDGB5; MDDGC5
Exon (3)108..258
Gene:FKRP
Gene Synonym:LGMD2I; MDC1C; MDDGA5; MDDGB5; MDDGC5
Exon (4)259..3422
Gene:FKRP
Gene Synonym:LGMD2I; MDC1C; MDDGA5; MDDGB5; MDDGC5
Translation MRLTRCQAALAAAITLNLLVLFYVSWLQHQPRNSRARGPRRASAAGPRVTVLVREFEAFD NAVPELVDSFLQQDPAQPVVVAADTLPYPPLALPRIPNVRLALLQPALDRPAAASRPETY VATEFVALVPDGARAEAPGLLERMVEALRAGSARLVAAPVATANPARCLALNVSLREWTA RYGAAPAAPRCDALDGDAVVLLRARDLFNLSAPLARPVGTSLFLQTALRGWAVQLLDLTF AAARQPPLATAHARWKAEREGRARRAALLRALGIRLVSWEGGRLEWFGCNKETTRCFGTV VGDTPAYLYEERWTPPCCLRALRETARYVVGVLEAAGVRYWLEGGSLLGAARHGDIIPWD YDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEKAVEGDFFRVQYSESNHLHVDLWPF YPRNGVMTKDTWLDHRQDVEFPEHFLQPLVPLPFAGFVAQAPNNYRRFLELKFGPGVIEN PQYPNPALLSLTGSG
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
49+dbSNP:
49+c, tdbSNP:189133927
52+a, gdbSNP:181509391
110+dbSNP:
110+g, tdbSNP:186129206
114+g, tdbSNP:112119770
192+c, tdbSNP:181239325
244..246+, actdbSNP:36215246
254+c, tdbSNP:1693995
264+dbSNP:
264+c, tdbSNP:3201779
295+a, cdbSNP:369017129
315+c, tdbSNP:373388363
365+a, gdbSNP:201951207
384+c, gdbSNP:112243410
419+g, tdbSNP:201497063
432+c, tdbSNP:2287717
457+c, g, tdbSNP:28937905
488+c, tdbSNP:376779706
489+c, tdbSNP:111754012
531+c, tdbSNP:145283847
532+a, gdbSNP:104894683
546+c, tdbSNP:149030303
638+c, gdbSNP:143793528
697+c, tdbSNP:104894690
701+a, cdbSNP:398124392
724+a, cdbSNP:148206382
753+c, gdbSNP:199714523
817+a, tdbSNP:200990647
864+c, tdbSNP:201454433
878+a, tdbSNP:398124393
882+c, tdbSNP:75079578
903+a, gdbSNP:140084192
933+a, gdbSNP:370099812
955+a, cdbSNP:201648309
960+a, cdbSNP:28937902
993+g, tdbSNP:398124394
1061+a, gdbSNP:104894689
1119+c, gdbSNP:77138370
1123+a, cdbSNP:28937900
1196+c, tdbSNP:104894691
1216+a, tdbSNP:104894692
1223+a, gdbSNP:104894679
1235+g, tdbSNP:200025577
1238+c, tdbSNP:398124395
1243+a, cdbSNP:28937901
1250+a, gdbSNP:104894684
1317+c, tdbSNP:77351928
1370+c, tdbSNP:143031195
1416+a, cdbSNP:370575962
1433+a, gdbSNP:140217866
1441+a, gdbSNP:60831455
1451+a, c, tdbSNP:104894680
1452+a, gdbSNP:369432328
1455+c, gdbSNP:373719817
1474+a, gdbSNP:140679502
1476+a, gdbSNP:145894568
1520+a, gdbSNP:376739436
1533+c, tdbSNP:201076863
1539+c, tdbSNP:369599106
1560+c, tdbSNP:138350337
1563+c, gdbSNP:374056230
1568+a, gdbSNP:376989573
1603+c, tdbSNP:144236975
1622+c, tdbSNP:148318216
1640+c, tdbSNP:104894681
1661+a, cdbSNP:28937903
1684+a, gdbSNP:121908110
1702+c, tdbSNP:143129484
1724+a, gdbSNP:375326964
1736+a, tdbSNP:369666163
1737+c, tdbSNP:115365212
1762+c, tdbSNP:112819526
1779+a, cdbSNP:373244438
1783+a, tdbSNP:104894682
1851+a, gdbSNP:185647378
2046+c, tdbSNP:374197881
2083+c, tdbSNP:73060707
2093+a, tdbSNP:116045816
2183+a, gdbSNP:114529423
2605+c, gdbSNP:114279721
2855+a, gdbSNP:143495212
3105+a, cdbSNP:116772963
3186+a, gdbSNP:147197243
3355+a, tdbSNP:79237838
3356+a, tdbSNP:77120601
Gene SymbolFKRP
Gene SynonymLGMD2I; MDC1C; MDDGA5; MDDGB5; MDDGC5
Chromosome19
Locus Map19q13.32
Title Limb-girdle muscular dystrophy type 2I is not rare in Taiwan .
Author Liang WC, Hayashi YK, Ogawa M, Wang CH, Huang WT, Nishino I and Jong YJ.
Journal Neuromuscul. Disord. 23 (8), 675-681 (2013)
Title The proteoglycan-dystrophin complex in genetic cardiomyopathies--lessons from three siblings with limb-girdle muscular dystrophy-2I (LGMD-2I) .
Author Yilmaz,A., Gdynia,H.J., Ponfick,M., Ludolph,A.C., Rosch,S. and Sechtem,U.
Journal Clin Res Cardiol 100 (7), 611-615 (2011)
Title SNP-array based whole genome homozygosity mapping: a quick and powerful tool to achieve an accurate diagnosis in LGMD2 patients .
Author Papic L, Fischer D, Trajanoski S, Hoftberger R, Fischer C, Strobel T, Schmidt WM, Bittner RE, Schabhuttl M, Gruber K, Pieber TR, Janecke AR and Auer-Grumbach M.
Journal Eur J Med Genet 54 (3), 214-219 (2011)
Title Asian patients with limb girdle muscular dystrophy 2I (LGMD2I) .
Author Hong D, Zhang W, Wang W, Wang Z and Yuan Y.
Journal J Clin Neurosci 18 (4), 494-499 (2011)
Title Fukutin-related protein resides in the Golgi cisternae of skeletal muscle fibres and forms disulfide-linked homodimers via an N-terminal interaction .
Author Alhamidi M, Kjeldsen Buvang E, Fagerheim T, Brox V, Lindal S, Van Ghelue M and Nilssen O.
Journal PLoS ONE 6 (8), E22968 (2011)
Title Mutations in the fukutin-related protein gene (FKRP) cause a form of congenital muscular dystrophy with secondary laminin alpha2 deficiency and abnormal glycosylation of alpha-dystroglycan .
Author Brockington M, Blake DJ, Prandini P, Brown SC, Torelli S, Benson MA, Ponting CP, Estournet B, Romero NB, Mercuri E, Voit T, Sewry CA, Guicheney P and Muntoni F.
Journal Am. J. Hum. Genet. 69 (6), 1198-1209 (2001)
Title Merosin-deficient congenital muscular dystrophy with mental retardation and cerebellar cysts unlinked to the LAMA2, FCMD and .
Author Talim B, Ferreiro A, Cormand B, Vignier N, Oto A, Gogus S, Cila A, Lehesjoki AE, Pihko H, Guicheney P and Topaloglu H.
Journal Neuromuscul. Disord. 10 (8), 548-552 (2000)
Title Congenital muscular dystrophy with secondary merosin deficiency and normal brain MRI: a novel entity? .
Author Mercuri E, Sewry CA, Brown SC, Brockington M, Jungbluth H, DeVile C, Counsell S, Manzur A and Muntoni F.
Journal Neuropediatrics 31 (4), 186-189 (2000)
Title A single human myosin light chain kinase gene (MLCK; MYLK) .
Author Lazar V and Garcia JG.
Journal Genomics 57 (2), 256-267 (1999)
Title Congenital Muscular Dystrophy Overview .
Author Sparks,S., Quijano-Roy,S., Harper,A., Rutkowski,A., Gordon,E., Hoffman,E.P. and Pegoraro,E.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.