• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens leucine-rich repeat kinase 1 (LRRK1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_024652 Homo sapiens leucine-rich repeat kinase 1 (LRRK1), mRNA. GenEZ ORF Cloning On-demand $3749.00 35

*Business Day

Related Services

RefSeq Version NM_024652.3, 90991701
Length 7647 bp
Structure linear
Update Date 22-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens leucine-rich repeat kinase 1 (LRRK1), mRNA.
Product leucine-rich repeat serine/threonine-protein kinase 1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AW592808.1, BC068080.1, DQ013130.1, AB058693.1, AK131075.1 and BQ187037.1. On Apr 4, 2006 this sequence version replaced gi:33469142.

RefSeq NP_078928.3
CDS 320..6367
Misc Feature(1)242..244
Misc Feature(2)491..742
Misc Feature(3)491..742
Misc Feature(4)575..667
Misc Feature(5)602..961
Misc Feature(6)674..763
Misc Feature(7)695..982
Misc Feature(8)773..865
Misc Feature(9)896..985
Misc Feature(10)<959..1783
Misc Feature(11)order(959..961,968..970,974..976,983..985,989..991,
Misc Feature(12)order(980..982,1181..1183,1250..1252,1484..1486,
Misc Feature(13)1154..1219
Misc Feature(14)1223..1405
Misc Feature(15)1226..1291
Misc Feature(16)1304..1567
Misc Feature(17)1307..1372
Misc Feature(18)1376..1441
Misc Feature(19)1454..2242
Misc Feature(20)1460..1525
Misc Feature(21)order(1463..1465,1472..1474,1478..1480,1487..1489,
Misc Feature(22)order(1481..1486,1619..1621,1835..1837,1907..1909,
Misc Feature(23)1532..1597
Misc Feature(24)1598..1660
Misc Feature(25)1670..1846
Misc Feature(26)1670..1735
Misc Feature(27)1739..1804
Misc Feature(28)1811..1876
Misc Feature(29)1961..2122
Misc Feature(30)1964..2029
Misc Feature(31)2033..2101
Misc Feature(32)2105..2170
Misc Feature(33)2222..>2662
Misc Feature(34)2234..2782
Misc Feature(35)2252..2275
Misc Feature(36)order(2258..2278,2423..2425,2588..2593,2597..2599,
Misc Feature(37)2318..2320
Misc Feature(38)2339..2347
Misc Feature(39)2414..2425
Misc Feature(40)order(2420..2425,2471..2476)
Misc Feature(41)2588..2599
Misc Feature(42)2732..2740
Misc Feature(43)4052..4894
Misc Feature(44)4061..4879
Misc Feature(45)order(4061..4075,4085..4087,4121..4123,4127..4129,
Misc Feature(46)order(4061..4075,4085..4087,4121..4123,4127..4129,
Misc Feature(47)order(4073..4075,4340..4342,4346..4348,4475..4477,
Misc Feature(48)order(4541..4561,4595..4606)
Exon (1)1..197
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (2)198..416
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (3)417..580
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (4)581..752
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (5)753..932
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (6)933..1081
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (7)1082..1308
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (8)1309..1436
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (9)1437..1600
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (10)1601..1738
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (11)1739..1851
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (12)1852..1928
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (13)1929..2058
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (14)2059..2171
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (15)2172..2386
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (16)2387..2551
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (17)2552..2724
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (18)2725..2845
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (19)2846..3005
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (20)3006..3282
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (21)3283..3454
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (22)3455..3618
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (23)3619..3758
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (24)3759..4008
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (25)4009..4175
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (26)4176..4373
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (27)4374..4651
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (28)4652..4846
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (29)4847..4998
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (30)4999..5116
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (31)5117..5233
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (32)5234..6087
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (33)6088..6189
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (34)6190..7631
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Translation MAGMSQRPPSMYWCVGPEESAVCPERAMETLNGAGDTGGKPSTRGGDPAARSRRTEGIRA AYRRGDRGGARDLLEEACDQCASQLEKGQLLSIPAAYGDLEMVRYLLSKRLVELPTEPTD DNPAVVAAYFGHTAVVQELLESLPGPCSPQRLLNWMLALACQRGHLGVVKLLVLTHGADP ESYAVRKNEFPVIVRLPLYAAIKSGNEDIAIFLLRHGAYFCSYILLDSPDPSKHLLRKYF IEASPLPSSYPGKTALRVKWSHLRLPWVDLDWLIDISCQITELDLSANCLATLPSVIPWG LINLRKLNLSDNHLGELPGVQSSDEIICSRLLEIDISSNKLSHLPPGFLHLSKLQKLTAS KNCLEKLFEEENATNWIGLRKLQELDISDNKLTELPALFLHSFKSLNSLNVSRNNLKVFP DPWACPLKCCKASRNALECLPDKMAVFWKNHLKDVDFSENALKEVPLGLFQLDALMFLRL QGNQLAALPPQEKWTCRQLKTLDLSRNQLGKNEDGLKTKRIAFFTTRGRQRSGTEAASVL EFPAFLSESLEVLCLNDNHLDTVPPSVCLLKSLSELYLGNNPGLRELPPELGQLGNLWQL DTEDLTISNVPAEIQKEGPKAMLSYLRAQLRKAEKCKLMKMIIVGPPRQGKSTLLEILQT GRAPQVVHGEATIRTTKWELQRPAGSRAKVESVEFNVWDIGGPASMATVNQCFFTDKALY VVVWNLALGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAKFRVERIATLRAYVLA LCRSPSGSRATGFPDITFKHLHEISCKSLEGQEGLRQLIFHVTCSMKDVGSTIGCQRLAG RLIPRSYLSLQEAVLAEQQRRSRDDDVQYLTDRQLEQLVEQTPDNDIKDYEDLQSAISFL IETGTLLHFPDTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIRAEDLRMLLVG TGFTQQTEEQYFQFLAKFEIALPVANDSYLLPHLLPSKPGLDTHGMRHPTANTIQRVFKM SFVPVGFWQRFIARMLISLAEMDLQLFENKKNTKSRNRKVTIYSFTGNQRNRCSTFRVKR NQTIYWQEGLLVTFDGGYLSVESSDVNWKKKKSGGMKIVCQSEVRDFSAMAFITDHVNSL IDQWFPALTATESDGTPLMEQYVPCPVCETAWAQHTDPSEKSEDVQYFDMEDCVLTAIER DFISCPRHPDLPVPLQELVPELFMTDFPARLFLENSKLEHSEDEGSVLGQGGSGTVIYRA RYQGQPVAVKRFHIKKFKNFANVPADTMLRHLRATDAMKNFSEFRQEASMLHALQHPCIV ALIGISIHPLCFALELAPLSSLNTVLSENARDSSFIPLGHMLTQKIAYQIASGLAYLHKK NIIFCDLKSDNILVWSLDVKEHINIKLSDYGISRQSFHEGALGVEGTPGYQAPEIRPRIV YDEKVDMFSYGMVLYELLSGQRPALGHHQLQIAKKLSKGIRPVLGQPEEVQFRRLQALMM ECWDTKPEKRPLALSVVSQMKDPTFATFMYELCCGKQTAFFSSQGQEYTVVFWDGKEESR NYTVVNTEKGLMEVQRMCCPGMKVSCQLQVQRSLWTATEDQKIYIYTLKGMCPLNTPQQA LDTPAVVTCFLAVPVIKKNSYLVLAGLADGLVAVFPVVRGTPKDSCSYLCSHTANRSKFS IADEDARQNPYPVKAMEVVNSGSEVWYSNGPGLLVIDCASLEICRRLEPYMAPSMVTSVV CSSEGRGEEVVWCLDDKANSLVMYHSTTYQLCARYFCGVPSPLRDMFPVRPLDTEPPAAS HTANPKVPEGDSIADVSIMYSEELGTQILIHQESLTDYCSMSSYSSSPPRQAARSPSSLP SSPASSSSVPFSTDCEDSDMLHTPGAASDRSEHDLTPMDGETFSQHLQAVKILAVRDLIW VPRRGGDVIVIGLEKDSGAQRGRVIAVLKARELTPHGVLVDAAVVAKDTVVCTFENENTE WCLAVWRGWGAREFDIFYQSYEELGRLEACTRKRR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
115+dbSNP:
115+a, gdbSNP:371417142
199+dbSNP:
199+g, tdbSNP:12148466
231+a, cdbSNP:73480674
complement(254)-t, cdbSNP:144839182
275+a, gdbSNP:374701916
287+c, tdbSNP:374575045
329+a, gdbSNP:201543283
334+a, gdbSNP:201093318
341+c, tdbSNP:373263143
342+c, tdbSNP:201657615
369+c, tdbSNP:180759486
397+c, tdbSNP:11630691
411+g, tdbSNP:376424624
427+dbSNP:
427+c, tdbSNP:78079181
454+c, tdbSNP:377386363
521+a, gdbSNP:56289455
565+c, gdbSNP:76356473
578+a, gdbSNP:28468535
599+dbSNP:
599+c, tdbSNP:202037702
600+c, tdbSNP:370948444
601+a, gdbSNP:374170949
606+a, cdbSNP:377500835
625+g, tdbSNP:200799740
642+a, gdbSNP:202052348
676+a, gdbSNP:367646702
703+a, gdbSNP:56023187
706+, tdbSNP:35173904
717+c, tdbSNP:200045067
727+a, gdbSNP:371796623
729+a, gdbSNP:201198678
737+c, gdbSNP:374355989
807+dbSNP:
807+a, gdbSNP:200548454
811+a, gdbSNP:183858799
817+g, tdbSNP:199710239
843+c, tdbSNP:202112893
847+c, tdbSNP:373692571
859+a, gdbSNP:200144474
883+c, tdbSNP:376621989
899+a, gdbSNP:370235958
902+c, tdbSNP:201889926
919+a, gdbSNP:201045485
926+a, gdbSNP:35985016
963+dbSNP:
963+a, gdbSNP:368091026
989+a, gdbSNP:113989128
1040+a, cdbSNP:145072406
1047+a, cdbSNP:201348332
1070+c, gdbSNP:369239695
1071..1072+, a, gdbSNP:369055973
1071+c, tdbSNP:200690035
1072+c, tdbSNP:2412000
1072+c, tdbSNP:386566714
1074+, gdbSNP:376627461
1107+dbSNP:
1107+a, tdbSNP:369330842
1146+g, tdbSNP:199863201
1197+g, tdbSNP:373434869
1233+a, gdbSNP:201297016
1261+g, tdbSNP:202029522
1276+a, cdbSNP:370276250
1277+a, gdbSNP:376445041
1291+c, gdbSNP:184008590
1333+dbSNP:
1333+c, gdbSNP:368549166
1336+c, tdbSNP:372319954
1359+a, gdbSNP:187360115
1382+c, gdbSNP:150351407
1384+a, gdbSNP:375493724
1412..1413+, tdbSNP:34252067
1423+c, tdbSNP:375815703
1424+a, gdbSNP:372847198
1437+dbSNP:
1437+c, tdbSNP:368813810
1443+a, gdbSNP:372555242
1452+c, gdbSNP:200469257
1491+a, tdbSNP:371086173
1508+g, tdbSNP:200253977
1554+c, gdbSNP:375638857
1565+a, cdbSNP:55739947
1570+a, gdbSNP:376711227
1603+dbSNP:
1603+a, gdbSNP:368142344
1605+a, gdbSNP:201450091
1618+c, tdbSNP:372256745
1648+a, gdbSNP:376835233
complement(1662)-t, gdbSNP:76152020
1679+g, tdbSNP:200529094
1699+c, tdbSNP:200133283
1700+a, gdbSNP:113678526
1716+c, tdbSNP:371606687
1738+c, tdbSNP:374867216
1751+dbSNP:
1751+c, tdbSNP:373397140
1776+c, tdbSNP:377571378
1825+a, gdbSNP:370654470
1870+dbSNP:
1870+a, gdbSNP:371899304
1891+c, tdbSNP:375733293
1910+c, gdbSNP:200499483
1918+a, gdbSNP:368413148
1946+dbSNP:
1946+c, tdbSNP:55798315
1948+a, gdbSNP:201783525
1987+c, tdbSNP:56215707
1996+c, tdbSNP:370129944
2016+c, tdbSNP:141522582
2017+a, gdbSNP:182944219
2041+a, gdbSNP:377627843
2077+dbSNP:
2077+g, tdbSNP:199792081
2095+a, gdbSNP:199900396
2107+c, tdbSNP:201182477
2145+a, gdbSNP:376893013
2172+dbSNP:
2172+c, gdbSNP:80186667
2189+a, tdbSNP:200770615
2210+c, tdbSNP:192470343
2215+a, gdbSNP:41381646
2221+a, gdbSNP:74990541
2249+a, gdbSNP:375903897
2251+c, gdbSNP:78739687
2255+c, tdbSNP:377316707
2261+c, tdbSNP:200971195
2279+a, cdbSNP:34885781
2377+a, gdbSNP:11247253
2377+c, tdbSNP:386517784
2393+dbSNP:
2393+a, tdbSNP:200409352
2396+a, gdbSNP:201243082
2407+c, tdbSNP:76435780
2408+a, gdbSNP:141102052
2427+c, tdbSNP:150261606
2428+a, gdbSNP:181816210
2463+c, gdbSNP:78191111
2479+c, tdbSNP:370622775
2480+a, gdbSNP:199919214
2516+a, gdbSNP:370663048
2548+c, tdbSNP:367700715
2549+g, tdbSNP:371661382
2560+dbSNP:
2560+c, tdbSNP:373323446
2566+c, tdbSNP:375396531
2570+a, gdbSNP:141579296
2572+a, gdbSNP:55707671
2584+c, tdbSNP:147972383
2602+a, cdbSNP:199817137
2631+c, tdbSNP:201803929
2634+c, tdbSNP:373497333
2637+c, tdbSNP:377308921
2638+a, gdbSNP:56251243
2643+a, gdbSNP:368099995
2677+c, tdbSNP:370178353
2678+a, gdbSNP:367783860
2747+dbSNP:
2747+a, gdbSNP:372434815
2759+a, gdbSNP:200114885
2779+c, tdbSNP:267604400
2782+c, tdbSNP:114809158
2791+c, tdbSNP:201411182
2799+a, gdbSNP:373879296
2803+c, tdbSNP:149998498
2804+a, gdbSNP:202077818
2806+c, gdbSNP:41319544
2807+a, gdbSNP:200452644
2811+a, gdbSNP:186890317
2817+a, tdbSNP:370572047
2840+c, tdbSNP:375374079
2848+dbSNP:
2848+c, tdbSNP:374330724
2879+a, gdbSNP:368404584
2898+a, gdbSNP:142470911
2905+c, tdbSNP:55922118
2911+c, tdbSNP:375029219
2912+a, gdbSNP:202089769
2914+c, tdbSNP:368817453
2915+a, gdbSNP:56003881
2918+a, gdbSNP:374008052
2932+a, gdbSNP:377634889
2964+c, tdbSNP:201854079
2974+c, tdbSNP:41535348
2982+a, gdbSNP:77112930
3012+dbSNP:
3012+c, gdbSNP:200667677
3028+c, tdbSNP:370260141
3086+c, gdbSNP:200062338
3103+c, tdbSNP:137936039
3138+c, gdbSNP:185373027
3178+a, cdbSNP:190712554
3183+a, gdbSNP:201392064
3211+a, gdbSNP:61733311
3219+c, tdbSNP:41531245
3220+a, gdbSNP:180728790
3221+a, gdbSNP:369170053
3233+c, tdbSNP:374599598
3241+c, gdbSNP:201547686
3259+c, tdbSNP:368117803
3262+c, tdbSNP:41478246
3268+c, tdbSNP:374874498
3269+a, gdbSNP:369265377
3276+a, gdbSNP:199709127
3280+c, tdbSNP:377315974
3316+dbSNP:
3316+c, tdbSNP:181386905
3325+c, tdbSNP:374354572
3335+a, gdbSNP:368618286
3338+c, tdbSNP:370459525
3339+a, gdbSNP:367709807
3355+c, tdbSNP:200887175
3391+c, gdbSNP:143276193
3394+c, tdbSNP:377173315
3396+c, gdbSNP:368567214
3419+c, tdbSNP:372293144
3533+dbSNP:
3533+c, tdbSNP:376281560
3614+c, tdbSNP:200404538
3632+dbSNP:
3632+a, gdbSNP:78587240
3634+c, tdbSNP:371351101
3635+c, gdbSNP:200111263
3673+a, tdbSNP:41425846
3692+a, gdbSNP:373841325
3712+c, tdbSNP:181742254
3720+c, gdbSNP:61733312
3721+a, gdbSNP:79667819
3742+a, tdbSNP:41339845
3758+g, tdbSNP:376554922
3760+dbSNP:
3760+a, cdbSNP:116807808
3766+a, gdbSNP:4965778
3772+a, cdbSNP:200982447
3817+a, gdbSNP:199698040
3846+c, tdbSNP:369305577
3847+a, gdbSNP:201580059
3861+a, gdbSNP:374717787
3873+g, tdbSNP:200666835
3876+a, gdbSNP:373432119
3883+c, tdbSNP:149260825
3913+c, tdbSNP:369473298
3920+a, gdbSNP:267604401
3956+a, gdbSNP:199624259
3960+c, tdbSNP:370568105
3961+a, gdbSNP:375373859
3994+c, tdbSNP:377378620
4002+c, tdbSNP:370451042
4026+dbSNP:
4026+a, gdbSNP:375762978
4030+c, gdbSNP:370150056
4034+c, gdbSNP:373500031
4042+a, cdbSNP:377311326
4058+a, gdbSNP:200086296
4069+a, gdbSNP:369708016
4073+a, gdbSNP:373729202
4078..4079+, gdbSNP:35250774
4084+c, tdbSNP:377557706
4088+a, gdbSNP:201939674
4095+a, gdbSNP:200606953
4101+a, gdbSNP:199933427
4123+c, tdbSNP:371462084
4131+a, gdbSNP:199804667
4138+c, tdbSNP:56339648
4153+a, gdbSNP:200248531
4170+c, tdbSNP:145412332
4171+a, gdbSNP:78072688
4196+dbSNP:
4196+c, tdbSNP:367837232
4198+a, gdbSNP:372760472
4211+a, gdbSNP:201354127
4252+a, gdbSNP:78975797
4332+c, tdbSNP:200335851
4333+a, gdbSNP:200546224
4345+c, tdbSNP:41418955
4367+a, gdbSNP:77202443
4374+dbSNP:
4374+a, tdbSNP:55727462
4392..4393+, gdbSNP:34439850
4435+a, gdbSNP:376455076
4444+c, gdbSNP:370648813
4446+a, gdbSNP:368406955
4480+a, gdbSNP:41372244
4486+a, gdbSNP:201500206
4513+a, gdbSNP:386449250
4513+c, tdbSNP:77209958
4549+c, tdbSNP:41527944
4579+c, tdbSNP:201651735
4631+c, tdbSNP:199787324
4634+a, gdbSNP:371409478
4645+c, tdbSNP:377174221
4657+dbSNP:
4657+c, tdbSNP:142406039
4684+c, tdbSNP:61733306
4758+a, tdbSNP:377318134
4765+a, gdbSNP:370936858
4779+c, tdbSNP:201964335
4780+a, gdbSNP:368089358
4796+c, tdbSNP:374925554
4797+a, gdbSNP:367806940
4810+a, gdbSNP:202198743
4817+a, cdbSNP:376349366
4837+a, gdbSNP:368184596
4852+dbSNP:
4852+a, gdbSNP:11857803
4864+a, gdbSNP:373072195
4888+a, gdbSNP:201190527
4899+c, tdbSNP:369644113
4939+a, cdbSNP:377128940
4966+c, tdbSNP:11853661
5014+dbSNP:
5014+c, gdbSNP:368629610
5039+g, tdbSNP:371591965
5050+a, gdbSNP:61733307
5155+dbSNP:
5155+c, tdbSNP:374002058
5158+a, cdbSNP:201344125
5254+dbSNP:
5254+c, gdbSNP:150351638
5278..5279+, ggdbSNP:370950223
5280+g, tdbSNP:76666049
5285+c, tdbSNP:74775581
5288+a, gdbSNP:200281447
5295+a, gdbSNP:370180202
5304+c, tdbSNP:373755921
5311+c, tdbSNP:200927450
5330+a, tdbSNP:371053735
5334+a, gdbSNP:375652666
5364+c, tdbSNP:368322542
5375+a, gdbSNP:370749356
5378+c, tdbSNP:373893782
5418+a, gdbSNP:189062191
5422+c, tdbSNP:190667875
5423+a, gdbSNP:78605716
5427+a, cdbSNP:372292557
5477+c, tdbSNP:76740676
5479+c, tdbSNP:376736555
5495+c, tdbSNP:77374252
5500+a, gdbSNP:138014754
5508+a, gdbSNP:374196433
5522+a, gdbSNP:3829706
5530+a, gdbSNP:376774894
5536+c, tdbSNP:41373050
5570+a, gdbSNP:373452117
5599+c, gdbSNP:199530216
5606+a, tdbSNP:373287839
5640+a, gdbSNP:201726240
5651+a, gdbSNP:146084570
5655+a, tdbSNP:3764738
5669..5670+, gdbSNP:34626379
5683+c, tdbSNP:370640930
5699+a, gdbSNP:368408781
5706+a, cdbSNP:34876840
5710+a, gdbSNP:374983079
5731+a, cdbSNP:200557780
5733+c, tdbSNP:199974382
5740+c, gdbSNP:375331204
5759+a, gdbSNP:35787282
5761+a, gdbSNP:116529941
5765+a, gdbSNP:377185660
5770+c, tdbSNP:187714725
5774+a, gdbSNP:368591954
5797+a, gdbSNP:55897723
5822+c, tdbSNP:35128996
5824+c, tdbSNP:184153025
5856+c, tdbSNP:201730508
5860+c, gdbSNP:202046983
5867+c, tdbSNP:41525944
5868+a, gdbSNP:200771530
5882+g, tdbSNP:61733308
5884+c, tdbSNP:368869252
5892+a, gdbSNP:34874770
5938+c, tdbSNP:3764739
5944+c, tdbSNP:376376580
5945+a, gdbSNP:369774424
5961+g, tdbSNP:373539914
5967+c, tdbSNP:3764740
5971+c, tdbSNP:17161161
5972+a, gdbSNP:377202593
5983+c, tdbSNP:192138582
6008+c, tdbSNP:370127139
6016+c, tdbSNP:367810590
6037+c, tdbSNP:373703455
6047+a, gdbSNP:372723036
6091+dbSNP:
6091+c, tdbSNP:41334650
6092+a, gdbSNP:369056591
6107+a, gdbSNP:201481845
6119+c, gdbSNP:200916884
6132..6133+aa, gcdbSNP:386787404
6132+a, gdbSNP:2924835
6132+a, gdbSNP:386427818
6133+aa, gcdbSNP:375358524
6133+a, cdbSNP:2959197
6133+a, cdbSNP:56193104
6140+c, tdbSNP:373695236
6147+a, gdbSNP:376808685
6153+c, tdbSNP:370701948
6158+a, gdbSNP:375414450
6172+a, gdbSNP:377396108
6184+a, gdbSNP:184419743
6193+dbSNP:
6193+a, gdbSNP:368466207
6209+a, gdbSNP:371594206
6221+a, gdbSNP:200845343
6272+a, gdbSNP:200452795
6289+c, tdbSNP:199664807
6301+c, tdbSNP:202044372
6305+a, gdbSNP:200799960
6322+c, tdbSNP:370033723
6323+a, gdbSNP:3752321
6329+c, tdbSNP:61733309
6335+c, tdbSNP:373483365
6336+a, gdbSNP:377568599
6340+g, tdbSNP:55863220
6354+a, gdbSNP:370159409
6355+c, tdbSNP:373332516
6409+a, gdbSNP:376262723
6425+c, tdbSNP:3829707
6436..6437+, atcdbSNP:377424019
complement(6455)-g, adbSNP:144382607
6528+a, gdbSNP:62021239
6561+a, gdbSNP:118031484
6587+a, gdbSNP:73490932
6598..6599+, tadbSNP:369612904
6718+a, gdbSNP:143211300
complement(6737)-g, adbSNP:147497941
6768+, cdbSNP:149530598
6769+c, tdbSNP:191983219
6870+c, tdbSNP:183745132
6953+a, gdbSNP:75669738
6954+g, tdbSNP:144267311
6959+c, tdbSNP:1048326
7021+a, cdbSNP:147776611
7030+c, gdbSNP:188526238
7048+c, gdbSNP:193247615
7051+a, c, g, tdbSNP:1048327
7076+a, cdbSNP:185705612
7092+, adbSNP:370585336
complement(7286)-g, cdbSNP:149965922
7367+a, gdbSNP:188117303
7369+c, tdbSNP:116132583
7397+c, tdbSNP:191433540
7431+a, gdbSNP:184047006
7562+g, tdbSNP:145079930
7580+a, gdbSNP:188733550
7601+c, gdbSNP:181413474
7608+c, tdbSNP:15342
Gene SymbolLRRK1
Gene SynonymRIPK6; Roco1
Chromosome15
Locus Map15q26.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_024652 Homo sapiens leucine-rich repeat kinase 1 (LRRK1), mRNA. On-demand $3749.00 35
XM_005254979 PREDICTED: Homo sapiens leucine-rich repeat kinase 1 (LRRK1), transcript variant X1, mRNA. On-demand $1699.00 25
Title Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus .
Author Lu Y, Vitart V, Burdon KP, Khor CC, Bykhovskaya Y, Mirshahi A, Hewitt AW, Koehn D, Hysi PG, Ramdas WD, Zeller T, Vithana EN, Cornes BK, Tay WT, Tai ES, Cheng CY, Liu J, Foo JN, Saw SM, Thorleifsson G, Stefansson K, Dimasi DP, Mills RA, Mountain J, Ang W, Hoehn R, Verhoeven VJ, Grus F, Wolfs R, Castagne R, Lackner KJ, Springelkamp H, Yang J, Jonasson F, Leung DY, Chen LJ, Tham CC, Rudan I, Vatavuk Z, Hayward C, Gibson J, Cree AJ, MacLeod A, Ennis S, Polasek O, Campbell H, Wilson JF, Viswanathan AC, Fleck B, Li X, Siscovick D, Taylor KD, Rotter JI, Yazar S, Ulmer M, Li J, Yaspan BL, Ozel AB, Richards JE, Moroi SE, Haines JL, Kang JH, Pasquale LR, Allingham RR, Ashley-Koch A, Mitchell P, Wang JJ, Wright AF, Pennell C, Spector TD, Young TL, Klaver CC, Martin NG, Montgomery GW, Anderson MG, Aung T, Willoughby CE, Wiggs JL, Pang CP, Thorsteinsdottir U, Lotery AJ, Hammond CJ, van Duijn CM, Hauser MA, Rabinowitz YS, Pfeiffer N, Mackey DA, Craig JE, Macgregor S and Wong TY.
Journal Nat. Genet. 45 (2), 155-163 (2013)
Title Human leucine-rich repeat kinase 1 and 2: intersecting or unrelated functions? .
Author Civiero L and Bubacco L.
Journal Biochem. Soc. Trans. 40 (5), 1095-1101 (2012)
Title EGFR-dependent phosphorylation of leucine-rich repeat kinase LRRK1 is important for proper endosomal trafficking of EGFR .
Author Ishikawa K, Nara A, Matsumoto K and Hanafusa H.
Journal Mol. Biol. Cell 23 (7), 1294-1306 (2012)
Title Biochemical characterization of highly purified leucine-rich repeat kinases 1 and 2 demonstrates formation of homodimers .
Author Civiero L, Vancraenenbroeck R, Belluzzi E, Beilina A, Lobbestael E, Reyniers L, Gao F, Micetic I, De Maeyer M, Bubacco L, Baekelandt V, Cookson MR, Greggio E and Taymans JM.
Journal PLoS ONE 7 (8), E43472 (2012)
Title Homo- and heterodimerization of ROCO kinases: LRRK2 kinase inhibition by the LRRK2 ROCO fragment .
Author Klein CL, Rovelli G, Springer W, Schall C, Gasser T and Kahle PJ.
Journal J. Neurochem. 111 (3), 703-715 (2009)
Title Variants in the LRRK1 gene and susceptibility to Parkinson's disease in Norway .
Author Haugarvoll K, Toft M, Ross OA, White LR, Aasly JO and Farrer MJ.
Journal Neurosci. Lett. 416 (3), 299-301 (2007)
Title Leucine-rich repeat kinase 1: a paralog of LRRK2 and a candidate gene for Parkinson's disease .
Author Taylor JP, Hulihan MM, Kachergus JM, Melrose HL, Lincoln SJ, Hinkle KM, Stone JT, Ross OA, Hauser R, Aasly J, Gasser T, Payami H, Wszolek ZK and Farrer MJ.
Journal Neurogenetics 8 (2), 95-102 (2007)
Title LRRK1 protein kinase activity is stimulated upon binding of GTP to its Roc domain .
Author Korr D, Toschi L, Donner P, Pohlenz HD, Kreft B and Weiss B.
Journal Cell. Signal. 18 (6), 910-920 (2006)
Title Analysis of the DNA sequence and duplication history of human chromosome 15 .
Author Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES and Nusbaum C.
Journal Nature 440 (7084), 671-675 (2006)
Title Roc, a Ras/GTPase domain in complex proteins .
Author Bosgraaf L and Van Haastert PJ.
Journal Biochim. Biophys. Acta 1643 (1-3), 5-10 (2003)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.