• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens leucine-rich repeat kinase 1 (LRRK1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_024652 Homo sapiens leucine-rich repeat kinase 1 (LRRK1), mRNA. GenEZ ORF Cloning On-demand $3749.00 35

*Business Day

Related Services

RefSeq Version NM_024652.3, 90991701
Length 7647 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens leucine-rich repeat kinase 1 (LRRK1), mRNA.
Product leucine-rich repeat serine/threonine-protein kinase 1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AW592808.1, BC068080.1, DQ013130.1, AB058693.1, AK131075.1 and BQ187037.1. On Apr 4, 2006 this sequence version replaced gi:33469142.

RefSeq NP_078928.3
CDS 320..6367
Misc Feature(1)242..244
Misc Feature(2)575..667
Misc Feature(3)575..667
Misc Feature(4)590..961
Misc Feature(5)674..763
Misc Feature(6)695..982
Misc Feature(7)773..865
Misc Feature(8)896..985
Misc Feature(9)<959..1711
Misc Feature(10)order(959..961,968..970,974..976,983..985,989..991,
Misc Feature(11)order(980..982,1181..1183,1250..1252,1484..1486,
Misc Feature(12)1151..1285
Misc Feature(13)1154..1219
Misc Feature(14)1226..1405
Misc Feature(15)1226..1291
Misc Feature(16)1307..1372
Misc Feature(17)1376..1513
Misc Feature(18)1376..1441
Misc Feature(19)1460..1525
Misc Feature(20)1532..1597
Misc Feature(21)1598..1660
Misc Feature(22)1670..1846
Misc Feature(23)1670..1735
Misc Feature(24)1739..1804
Misc Feature(25)1811..1876
Misc Feature(26)1964..2029
Misc Feature(27)2033..2101
Misc Feature(28)2105..2170
Misc Feature(29)2222..>2662
Misc Feature(30)2234..2782
Misc Feature(31)2252..2275
Misc Feature(32)order(2258..2278,2423..2425,2588..2593,2597..2599,
Misc Feature(33)2318..2320
Misc Feature(34)2339..2347
Misc Feature(35)2414..2425
Misc Feature(36)order(2420..2425,2471..2476)
Misc Feature(37)2588..2599
Misc Feature(38)2732..2740
Misc Feature(39)4052..4894
Misc Feature(40)4061..4879
Misc Feature(41)order(4061..4075,4085..4087,4121..4123,4127..4129,
Misc Feature(42)order(4061..4075,4085..4087,4121..4123,4127..4129,
Misc Feature(43)order(4073..4075,4340..4342,4346..4348,4475..4477,
Misc Feature(44)order(4541..4561,4595..4606)
Exon (1)1..197
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (2)198..416
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (3)417..580
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (4)581..752
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (5)753..932
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (6)933..1081
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (7)1082..1308
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (8)1309..1436
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (9)1437..1600
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (10)1601..1738
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (11)1739..1851
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (12)1852..1928
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (13)1929..2058
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (14)2059..2171
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (15)2172..2386
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (16)2387..2551
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (17)2552..2724
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (18)2725..2845
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (19)2846..3005
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (20)3006..3282
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (21)3283..3454
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (22)3455..3618
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (23)3619..3758
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (24)3759..4008
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (25)4009..4175
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (26)4176..4373
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (27)4374..4651
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (28)4652..4846
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (29)4847..4998
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (30)4999..5116
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (31)5117..5233
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (32)5234..6087
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (33)6088..6189
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Exon (34)6190..7631
Gene:LRRK1
Gene Synonym:RIPK6; Roco1
Translation MAGMSQRPPSMYWCVGPEESAVCPERAMETLNGAGDTGGKPSTRGGDPAARSRRTEGIRA AYRRGDRGGARDLLEEACDQCASQLEKGQLLSIPAAYGDLEMVRYLLSKRLVELPTEPTD DNPAVVAAYFGHTAVVQELLESLPGPCSPQRLLNWMLALACQRGHLGVVKLLVLTHGADP ESYAVRKNEFPVIVRLPLYAAIKSGNEDIAIFLLRHGAYFCSYILLDSPDPSKHLLRKYF IEASPLPSSYPGKTALRVKWSHLRLPWVDLDWLIDISCQITELDLSANCLATLPSVIPWG LINLRKLNLSDNHLGELPGVQSSDEIICSRLLEIDISSNKLSHLPPGFLHLSKLQKLTAS KNCLEKLFEEENATNWIGLRKLQELDISDNKLTELPALFLHSFKSLNSLNVSRNNLKVFP DPWACPLKCCKASRNALECLPDKMAVFWKNHLKDVDFSENALKEVPLGLFQLDALMFLRL QGNQLAALPPQEKWTCRQLKTLDLSRNQLGKNEDGLKTKRIAFFTTRGRQRSGTEAASVL EFPAFLSESLEVLCLNDNHLDTVPPSVCLLKSLSELYLGNNPGLRELPPELGQLGNLWQL DTEDLTISNVPAEIQKEGPKAMLSYLRAQLRKAEKCKLMKMIIVGPPRQGKSTLLEILQT GRAPQVVHGEATIRTTKWELQRPAGSRAKVESVEFNVWDIGGPASMATVNQCFFTDKALY VVVWNLALGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAKFRVERIATLRAYVLA LCRSPSGSRATGFPDITFKHLHEISCKSLEGQEGLRQLIFHVTCSMKDVGSTIGCQRLAG RLIPRSYLSLQEAVLAEQQRRSRDDDVQYLTDRQLEQLVEQTPDNDIKDYEDLQSAISFL IETGTLLHFPDTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIRAEDLRMLLVG TGFTQQTEEQYFQFLAKFEIALPVANDSYLLPHLLPSKPGLDTHGMRHPTANTIQRVFKM SFVPVGFWQRFIARMLISLAEMDLQLFENKKNTKSRNRKVTIYSFTGNQRNRCSTFRVKR NQTIYWQEGLLVTFDGGYLSVESSDVNWKKKKSGGMKIVCQSEVRDFSAMAFITDHVNSL IDQWFPALTATESDGTPLMEQYVPCPVCETAWAQHTDPSEKSEDVQYFDMEDCVLTAIER DFISCPRHPDLPVPLQELVPELFMTDFPARLFLENSKLEHSEDEGSVLGQGGSGTVIYRA RYQGQPVAVKRFHIKKFKNFANVPADTMLRHLRATDAMKNFSEFRQEASMLHALQHPCIV ALIGISIHPLCFALELAPLSSLNTVLSENARDSSFIPLGHMLTQKIAYQIASGLAYLHKK NIIFCDLKSDNILVWSLDVKEHINIKLSDYGISRQSFHEGALGVEGTPGYQAPEIRPRIV YDEKVDMFSYGMVLYELLSGQRPALGHHQLQIAKKLSKGIRPVLGQPEEVQFRRLQALMM ECWDTKPEKRPLALSVVSQMKDPTFATFMYELCCGKQTAFFSSQGQEYTVVFWDGKEESR NYTVVNTEKGLMEVQRMCCPGMKVSCQLQVQRSLWTATEDQKIYIYTLKGMCPLNTPQQA LDTPAVVTCFLAVPVIKKNSYLVLAGLADGLVAVFPVVRGTPKDSCSYLCSHTANRSKFS IADEDARQNPYPVKAMEVVNSGSEVWYSNGPGLLVIDCASLEICRRLEPYMAPSMVTSVV CSSEGRGEEVVWCLDDKANSLVMYHSTTYQLCARYFCGVPSPLRDMFPVRPLDTEPPAAS HTANPKVPEGDSIADVSIMYSEELGTQILIHQESLTDYCSMSSYSSSPPRQAARSPSSLP SSPASSSSVPFSTDCEDSDMLHTPGAASDRSEHDLTPMDGETFSQHLQAVKILAVRDLIW VPRRGGDVIVIGLEKDSGAQRGRVIAVLKARELTPHGVLVDAAVVAKDTVVCTFENENTE WCLAVWRGWGAREFDIFYQSYEELGRLEACTRKRR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
199+dbSNP:
199+g, tdbSNP:12148466
231+a, cdbSNP:73480674
254+c, tdbSNP:144839182
329+a, gdbSNP:201543283
334+a, gdbSNP:201093318
342+c, tdbSNP:201657615
369+c, tdbSNP:180759486
397+c, tdbSNP:11630691
427+dbSNP:
427+c, tdbSNP:78079181
521+a, gdbSNP:56289455
565+c, gdbSNP:76356473
578+a, gdbSNP:28468535
599+dbSNP:
599+c, tdbSNP:202037702
625+g, tdbSNP:200799740
642+a, gdbSNP:202052348
703+a, gdbSNP:56023187
706+, tdbSNP:35173904
717+c, tdbSNP:200045067
729+a, gdbSNP:201198678
807+dbSNP:
807+a, gdbSNP:200548454
811+a, gdbSNP:183858799
817+g, tdbSNP:199710239
843+c, tdbSNP:202112893
859+a, gdbSNP:200144474
902+c, tdbSNP:201889926
919+a, gdbSNP:201045485
926+a, gdbSNP:35985016
989+dbSNP:
989+a, gdbSNP:113989128
1040+a, cdbSNP:145072406
1047+a, cdbSNP:201348332
1071+c, tdbSNP:200690035
1072+c, tdbSNP:2412000
1146+dbSNP:
1146+g, tdbSNP:199863201
1233+a, gdbSNP:201297016
1261+g, tdbSNP:202029522
1291+c, gdbSNP:184008590
1359+dbSNP:
1359+a, gdbSNP:187360115
1382+c, gdbSNP:150351407
1412..1413+, tdbSNP:34252067
1452+dbSNP:
1452+c, gdbSNP:200469257
1508+g, tdbSNP:200253977
1565+a, cdbSNP:55739947
1605+dbSNP:
1605+a, gdbSNP:201450091
1662+g, tdbSNP:76152020
1679+g, tdbSNP:200529094
1699+c, tdbSNP:200133283
1700+a, gdbSNP:113678526
1910+dbSNP:
1910+c, gdbSNP:200499483
1946+dbSNP:
1946+c, tdbSNP:55798315
1948+a, gdbSNP:201783525
1987+c, tdbSNP:56215707
2016+c, tdbSNP:141522582
2017+a, gdbSNP:182944219
2077+dbSNP:
2077+g, tdbSNP:199792081
2095+a, gdbSNP:199900396
2107+c, tdbSNP:201182477
2172+dbSNP:
2172+c, gdbSNP:80186667
2189+a, tdbSNP:200770615
2210+c, tdbSNP:192470343
2215+a, gdbSNP:41381646
2221+a, gdbSNP:74990541
2251+c, gdbSNP:78739687
2261+c, tdbSNP:200971195
2279+a, cdbSNP:34885781
2377+a, gdbSNP:11247253
2393+dbSNP:
2393+a, tdbSNP:200409352
2396+a, gdbSNP:201243082
2407+c, tdbSNP:76435780
2408+a, gdbSNP:141102052
2427+c, tdbSNP:150261606
2428+a, gdbSNP:181816210
2463+c, gdbSNP:78191111
2480+a, gdbSNP:199919214
2570+dbSNP:
2570+a, gdbSNP:141579296
2572+a, gdbSNP:55707671
2584+c, tdbSNP:147972383
2602+a, cdbSNP:199817137
2631+c, tdbSNP:201803929
2638+a, gdbSNP:56251243
2759+dbSNP:
2759+a, gdbSNP:200114885
2782+c, tdbSNP:114809158
2791+c, tdbSNP:201411182
2803+c, tdbSNP:149998498
2804+a, gdbSNP:202077818
2806+c, gdbSNP:41319544
2807+a, gdbSNP:200452644
2811+a, gdbSNP:186890317
2898+dbSNP:
2898+a, gdbSNP:142470911
2905+c, tdbSNP:55922118
2912+a, gdbSNP:202089769
2915+a, gdbSNP:56003881
2964+c, tdbSNP:201854079
2974+c, tdbSNP:41535348
2982+a, gdbSNP:77112930
3012+dbSNP:
3012+c, gdbSNP:200667677
3086+c, gdbSNP:200062338
3103+c, tdbSNP:137936039
3138+c, gdbSNP:185373027
3178+a, cdbSNP:190712554
3183+a, gdbSNP:201392064
3211+a, gdbSNP:61733311
3219+c, tdbSNP:41531245
3220+a, gdbSNP:180728790
3241+c, gdbSNP:201547686
3262+c, tdbSNP:41478246
3276+a, gdbSNP:199709127
3316+dbSNP:
3316+c, tdbSNP:181386905
3355+c, tdbSNP:200887175
3391+c, gdbSNP:143276193
3614+dbSNP:
3614+c, tdbSNP:200404538
3632+dbSNP:
3632+a, gdbSNP:78587240
3635+c, gdbSNP:200111263
3673+a, tdbSNP:41425846
3712+c, tdbSNP:181742254
3720+c, gdbSNP:61733312
3721+a, gdbSNP:79667819
3742+a, tdbSNP:41339845
3760+dbSNP:
3760+a, cdbSNP:116807808
3766+a, gdbSNP:4965778
3772+a, cdbSNP:200982447
3817+a, gdbSNP:199698040
3847+a, gdbSNP:201580059
3873+g, tdbSNP:200666835
3883+c, tdbSNP:149260825
3956+a, gdbSNP:199624259
4058+dbSNP:
4058+a, gdbSNP:200086296
4077..4078+, gdbSNP:35250774
4088+a, gdbSNP:201939674
4095+a, gdbSNP:200606953
4101+a, gdbSNP:199933427
4131+a, gdbSNP:199804667
4138+c, tdbSNP:56339648
4153+a, gdbSNP:200248531
4170+c, tdbSNP:145412332
4171+a, gdbSNP:78072688
4211+dbSNP:
4211+a, gdbSNP:201354127
4252+a, gdbSNP:78975797
4332+c, tdbSNP:200335851
4333+a, gdbSNP:200546224
4345+c, tdbSNP:41418955
4367+a, gdbSNP:77202443
4374+dbSNP:
4374+a, tdbSNP:55727462
4392..4393+, gdbSNP:34439850
4480+a, gdbSNP:41372244
4486+a, gdbSNP:201500206
4513+c, tdbSNP:77209958
4549+c, tdbSNP:41527944
4579+c, tdbSNP:201651735
4631+c, tdbSNP:199787324
4657+dbSNP:
4657+c, tdbSNP:142406039
4684+c, tdbSNP:61733306
4771..4772+, gdbSNP:67975094
4779+c, tdbSNP:201964335
4810+a, gdbSNP:202198743
4852+dbSNP:
4852+a, gdbSNP:11857803
4888+a, gdbSNP:201190527
4966+c, tdbSNP:11853661
5050+dbSNP:
5050+a, gdbSNP:61733307
5158+dbSNP:
5158+a, cdbSNP:201344125
5254+dbSNP:
5254+c, gdbSNP:150351638
5280+g, tdbSNP:76666049
5285+c, tdbSNP:74775581
5288+a, gdbSNP:200281447
5311+c, tdbSNP:200927450
5418+a, gdbSNP:189062191
5422+c, tdbSNP:190667875
5423+a, gdbSNP:78605716
5477+c, tdbSNP:76740676
5495+c, tdbSNP:77374252
5500+a, gdbSNP:138014754
5522+a, gdbSNP:3829706
5536+c, tdbSNP:41373050
5599+c, gdbSNP:199530216
5640+a, gdbSNP:201726240
5651+a, gdbSNP:146084570
5655+a, tdbSNP:3764738
5669..5670+, gdbSNP:34626379
5706+a, cdbSNP:34876840
5731+a, cdbSNP:200557780
5733+c, tdbSNP:199974382
5759+a, gdbSNP:35787282
5761+a, gdbSNP:116529941
5770+c, tdbSNP:187714725
5797+a, gdbSNP:55897723
5822+c, tdbSNP:35128996
5824+c, tdbSNP:184153025
5856+c, tdbSNP:201730508
5860+c, gdbSNP:202046983
5867+c, tdbSNP:41525944
5868+a, gdbSNP:200771530
5882+g, tdbSNP:61733308
5892+a, gdbSNP:34874770
5929..5930+, tdbSNP:67657544
5938+c, tdbSNP:3764739
5967+c, tdbSNP:3764740
5971+c, tdbSNP:17161161
5983+c, tdbSNP:192138582
6091+dbSNP:
6091+c, tdbSNP:41334650
6107+a, gdbSNP:201481845
6119+c, gdbSNP:200916884
6132..6133+a, cdbSNP:2959197
6132+a, gdbSNP:2924835
6133+a, cdbSNP:56193104
6184+a, gdbSNP:184419743
6221+dbSNP:
6221+a, gdbSNP:200845343
6272+a, gdbSNP:200452795
6289+c, tdbSNP:199664807
6301+c, tdbSNP:202044372
6305+a, gdbSNP:200799960
6323+a, gdbSNP:3752321
6329+c, tdbSNP:61733309
6340+g, tdbSNP:55863220
6425+c, tdbSNP:3829707
6455+a, gdbSNP:144382607
6528+a, gdbSNP:62021239
6561+a, gdbSNP:118031484
6587+a, gdbSNP:73490932
6718+a, gdbSNP:143211300
6737+a, gdbSNP:147497941
6768+, cdbSNP:149530598
6769+c, tdbSNP:191983219
6870+c, tdbSNP:183745132
6953+a, gdbSNP:75669738
6954+g, tdbSNP:144267311
6959+c, tdbSNP:1048326
7021+a, cdbSNP:147776611
7030+c, gdbSNP:188526238
7048+c, gdbSNP:193247615
7051+a, c, g, tdbSNP:1048327
7076+a, cdbSNP:185705612
7286+c, gdbSNP:149965922
7367+a, gdbSNP:188117303
7369+c, tdbSNP:116132583
7397+c, tdbSNP:191433540
7431+a, gdbSNP:184047006
7562+g, tdbSNP:145079930
7580+a, gdbSNP:188733550
7601+c, gdbSNP:181413474
7608+c, tdbSNP:15342
Gene SymbolLRRK1
Gene SynonymRIPK6; Roco1
Chromosome15
Locus Map15q26.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_024652 Homo sapiens leucine-rich repeat kinase 1 (LRRK1), mRNA. On-demand $3749.00 35
Title Human leucine-rich repeat kinase 1 and 2: intersecting or unrelated functions? .
Author Civiero,L. and Bubacco,L.
Journal Biochem. Soc. Trans. 40 (5), 1095-1101 (2012)
Title EGFR-dependent phosphorylation of leucine-rich repeat kinase LRRK1 is important for proper endosomal trafficking of EGFR .
Author Ishikawa,K., Nara,A., Matsumoto,K. and Hanafusa,H.
Journal Mol. Biol. Cell 23 (7), 1294-1306 (2012)
Title Biochemical characterization of highly purified leucine-rich repeat kinases 1 and 2 demonstrates formation of homodimers .
Author Civiero,L., Vancraenenbroeck,R., Belluzzi,E., Beilina,A., Lobbestael,E., Reyniers,L., Gao,F., Micetic,I., De Maeyer,M., Bubacco,L., Baekelandt,V., Cookson,M.R., Greggio,E. and Taymans,J.M.
Journal PLoS ONE 7 (8), E43472 (2012)
Title Homo- and heterodimerization of ROCO kinases: LRRK2 kinase inhibition by the LRRK2 ROCO fragment .
Author Klein,C.L., Rovelli,G., Springer,W., Schall,C., Gasser,T. and Kahle,P.J.
Journal J. Neurochem. 111 (3), 703-715 (2009)
Title Developmental regulation of leucine-rich repeat kinase 1 and 2 expression in the brain and other rodent and human organs: Implications for Parkinson's disease .
Author Westerlund,M., Belin,A.C., Anvret,A., Bickford,P., Olson,L. and Galter,D.
Journal Neuroscience 152 (2), 429-436 (2008)
Title Variants in the LRRK1 gene and susceptibility to Parkinson's disease in Norway .
Author Haugarvoll,K., Toft,M., Ross,O.A., White,L.R., Aasly,J.O. and Farrer,M.J.
Journal Neurosci. Lett. 416 (3), 299-301 (2007)
Title Leucine-rich repeat kinase 1: a paralog of LRRK2 and a candidate gene for Parkinson's disease .
Author Taylor,J.P., Hulihan,M.M., Kachergus,J.M., Melrose,H.L., Lincoln,S.J., Hinkle,K.M., Stone,J.T., Ross,O.A., Hauser,R., Aasly,J., Gasser,T., Payami,H., Wszolek,Z.K. and Farrer,M.J.
Journal Neurogenetics 8 (2), 95-102 (2007)
Title LRRK1 protein kinase activity is stimulated upon binding of GTP to its Roc domain .
Author Korr,D., Toschi,L., Donner,P., Pohlenz,H.D., Kreft,B. and Weiss,B.
Journal Cell. Signal. 18 (6), 910-920 (2006)
Title Analysis of the DNA sequence and duplication history of human chromosome 15 .
Author Zody,M.C., Garber,M., Sharpe,T., Young,S.K., Rowen,L., O'Neill,K., Whittaker,C.A., Kamal,M., Chang,J.L., Cuomo,C.A., Dewar,K., FitzGerald,M.G., Kodira,C.D., Madan,A., Qin,S., Yang,X., Abbasi,N., Abouelleil,A., Arachchi,H.M., Baradarani,L., Birditt,B., Bloom,S., Bloom,T., Borowsky,M.L., Burke,J., Butler,J., Cook,A., DeArellano,K., DeCaprio,D., Dorris,L. III, Dors,M., Eichler,E.E., Engels,R., Fahey,J., Fleetwood,P., Friedman,C., Gearin,G., Hall,J.L., Hensley,G., Johnson,E., Jones,C., Kamat,A., Kaur,A., Locke,D.P., Madan,A., Munson,G., Jaffe,D.B., Lui,A., Macdonald,P., Mauceli,E., Naylor,J.W., Nesbitt,R., Nicol,R., O'Leary,S.B., Ratcliffe,A., Rounsley,S., She,X., Sneddon,K.M., Stewart,S., Sougnez,C., Stone,S.M., Topham,K., Vincent,D., Wang,S., Zimmer,A.R., Birren,B.W., Hood,L., Lander,E.S. and Nusbaum,C.
Journal Nature 440 (7084), 671-675 (2006)
Title Roc, a Ras/GTPase domain in complex proteins .
Author Bosgraaf,L. and Van Haastert,P.J.
Journal Biochim. Biophys. Acta 1643 (1-3), 5-10 (2003)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.