• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens katanin p80 subunit B-like 1 (KATNBL1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_024713 Homo sapiens katanin p80 subunit B-like 1 (KATNBL1), mRNA. GenEZ ORF Cloning On-demand $449.00 14

*Business Day

Related Services

RefSeq Version NM_024713.2, 194688139
Length 2750 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens katanin p80 subunit B-like 1 (KATNBL1), mRNA.
Product KATNB1-like protein 1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK311338.1, AL136908.1, BX389537.2, BC026234.1 and BM831547.1. On Jul 30, 2008 this sequence version replaced gi:13376012.


##Evidence-Data-START## Transcript exon combination :: AL136908.1, AL833631.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025098 [ECO:0000348] ##Evidence-Data-END##

RefSeq NP_078989.1
CDS 161..1075
Misc Feature(1)152..154
Misc Feature(2)152..154
Misc Feature(3)602..1060
Misc Feature(4)602..1060
Exon (1)1..146
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (2)147..277
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (3)278..318
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (4)319..598
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (5)599..717
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (6)718..768
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (7)769..858
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (8)859..948
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (9)949..1042
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (10)1043..2740
Gene:KATNBL1
Gene Synonym:C15orf29
Translation MASETHNVKKRNFCNKIEDHFIDLPRKKISNFTNKNMKEVKKSPKQLAAYINRTVGQTVK SPDKLRKVIYRRKKVHHPFPNPCYRKKQSPGSGGCDMANKENELACAGHLPEKLHHDSRT YLVNSSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNMRLNVALTFWRKRSISEL VAYLLRIEDLGVVVDCLPVLTNCLQEEKQYISLGCCVDLLPLVKSLLKSKFEEYVIVGLN WLQAVIKRWWSELSSKTEIINDGNIQILKQQLSGLWEQENHLTLVPGYTGNIAKDVDAYL LQLH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(23)-dbSNP:
complement(23)-g, cdbSNP:116356981
complement(41)-g, cdbSNP:17525806
complement(45)-t, adbSNP:17525813
complement(63)-t, cdbSNP:2705106
complement(171)-t, gdbSNP:201043033
complement(244)-g, cdbSNP:201524096
complement(258)-g, cdbSNP:76630379
complement(342)-dbSNP:
complement(342)-g, cdbSNP:199944929
complement(362)-g, cdbSNP:74617641
complement(394)-g, c, adbSNP:112492109
complement(432)-c, adbSNP:148913855
complement(536)-t, cdbSNP:145452916
complement(560)-g, cdbSNP:201663750
complement(623)-dbSNP:
complement(623)-c, adbSNP:144230292
complement(641)-t, cdbSNP:112452087
complement(689)-t, cdbSNP:140318237
complement(706)-c, adbSNP:147579591
complement(707)-g, adbSNP:145138004
complement(849)-dbSNP:
complement(849)-t, cdbSNP:139830158
complement(861)-dbSNP:
complement(861)-t, cdbSNP:150678561
complement(896)-t, cdbSNP:200538549
complement(904)-t, cdbSNP:112364992
complement(921)-g, adbSNP:186125698
complement(989)-dbSNP:
complement(989)-t, cdbSNP:34998154
complement(1008)-g, cdbSNP:192899081
complement(1069)-dbSNP:
complement(1069)-t, cdbSNP:148593495
complement(1103)-t, cdbSNP:183333529
complement(1128)-g, adbSNP:2339370
complement(1147)-, tdbSNP:59162553
complement(1147)-, a, aaaadbSNP:3028163
complement(1237)-g, adbSNP:2339371
complement(1271)-g, adbSNP:2339372
complement(1314)-t, adbSNP:4041430
complement(1343)-g, adbSNP:3964624
complement(1348)-t, cdbSNP:190390812
complement(1479..1481)-, tttdbSNP:4041431
complement(1508)-t, gdbSNP:78691728
complement(1573)-, tdbSNP:147044048
complement(1654)-t, gdbSNP:115094254
complement(1665..1666)-, tdbSNP:57764295
complement(1816)-g, adbSNP:146580412
complement(1848)-g, adbSNP:150023340
complement(1849)-t, g, adbSNP:8031204
complement(1995)-t, cdbSNP:139382345
complement(2004)-g, cdbSNP:150902114
complement(2230)-g, adbSNP:181832917
complement(2268)-t, cdbSNP:17817770
complement(2301)-t, adbSNP:55792000
complement(2316)-t, cdbSNP:189490422
complement(2322..2323)-, cdbSNP:35587676
complement(2324)-g, adbSNP:111810212
complement(2353)-t, cdbSNP:186080751
complement(2447)-t, cdbSNP:142474248
complement(2489)-g, adbSNP:180694029
complement(2530)-t, cdbSNP:189505560
complement(2554)-t, cdbSNP:140272493
complement(2579..2580)-, gdbSNP:36090211
Gene SymbolKATNBL1
Gene SynonymC15orf29
Chromosome15
Locus Map15q14
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_024713 Homo sapiens katanin p80 subunit B-like 1 (KATNBL1), mRNA. On-demand $449.00 14
Title The spindle assembly function of Caenorhabditis elegans katanin does not require microtubule-severing activity .
Author McNally,K.P. and McNally,F.J.
Journal Mol. Biol. Cell 22 (9), 1550-1560 (2011)
Title Transcriptome analysis of human gastric cancer .
Author Oh,J.H., Yang,J.O., Hahn,Y., Kim,M.R., Byun,S.S., Jeon,Y.J., Kim,J.M., Song,K.S., Noh,S.M., Kim,S., Yoo,H.S., Kim,Y.S. and Kim,N.S.
Journal Mamm. Genome 16 (12), 942-954 (2005)
Title Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing .
Author Simpson,J.C., Wellenreuther,R., Poustka,A., Pepperkok,R. and Wiemann,S.
Journal EMBO Rep. 1 (3), 287-292 (2000)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.