Homo sapiens chromosome 15 open reading frame 29 (C15orf29), mRNA.
| RefSeq Version | NM_024713.2, 194688139 |
| Length | 2750 bp |
| Structure | linear |
| Update Date | 13-MAR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens chromosome 15 open reading frame 29 (C15orf29), mRNA. |
| Product | hypothetical protein LOC79768 |
| Comment | COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK311338.1, AL136908.1, BX389537.2, BC026234.1 and BM831547.1. On Jul 30, 2008 this sequence version replaced gi:13376012. |
| RefSeq | NP_078989.1 |
| CDS | 161..1075 | Exon (1) | 1..146 | Exon (2) | 1..146 | Exon (3) | 147..277 | Exon (4) | 278..318 | Exon (5) | 319..598 | Exon (6) | 599..717 | Exon (7) | 718..768 | Exon (8) | 769..858 | Exon (9) | 859..948 | Exon (10) | 949..1042 | Exon (11) | 1043..2740 |
| Translation | MASETHNVKKRNFCNKIEDHFIDLPRKKISNFTNKNMKEVKKSPKQLAAYINRTVGQTVK
SPDKLRKVIYRRKKVHHPFPNPCYRKKQSPGSGGCDMANKENELACAGHLPEKLHHDSRT
YLVNSSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNMRLNVALTFWRKRSISEL
VAYLLRIEDLGVVVDCLPVLTNCLQEEKQYISLGCCVDLLPLVKSLLKSKFEEYVIVGLN
WLQAVIKRWWSELSSKTEIINDGNIQILKQQLSGLWEQENHLTLVPGYTGNIAKDVDAYL
LQLH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| complement(23) | - | g, c | dbSNP:116356981 |
| 41 | + | c, g | dbSNP:17525806 |
| 45 | + | a, t | dbSNP:17525813 |
| complement(63) | - | t, c | dbSNP:2705106 |
| complement(258) | - | dbSNP: | |
| complement(258) | - | g, c | dbSNP:76630379 |
| complement(362) | - | g, c | dbSNP:74617641 |
| complement(394) | - | g, c | dbSNP:112492109 |
| complement(641) | - | t, c | dbSNP:112452087 |
| complement(904) | - | t, c | dbSNP:112364992 |
| complement(989) | - | t, c | dbSNP:34998154 |
| 1128 | + | a, g | dbSNP:2339370 |
| complement(1137) | - | , t | dbSNP:59162553 |
| complement(1138) | - | , t | dbSNP:72523307 |
| complement(1147) | - | , t | dbSNP:35272628 |
| 1147 | + | , aaaa | dbSNP:3028163 |
| 1237 | + | a, g | dbSNP:2339371 |
| 1271 | + | a, g | dbSNP:2339372 |
| 1314 | + | a, t | dbSNP:4041430 |
| 1343 | + | a, g | dbSNP:3964624 |
| 1479..1481 | + | , ttt | dbSNP:4041431 |
| complement(1508) | - | t, g | dbSNP:78691728 |
| complement(1654) | - | t, g | dbSNP:115094254 |
| complement(1665..1666) | - | , t | dbSNP:57764295 |
| complement(1710) | - | t, g | dbSNP:116991044 |
| complement(1849) | - | t, g, a | dbSNP:8031204 |
| complement(2268) | - | t, c | dbSNP:17817770 |
| complement(2301) | - | t, a | dbSNP:55792000 |
| complement(2322..2323) | - | , c | dbSNP:35587676 |
| complement(2324) | - | g, a | dbSNP:111810212 |
| complement(2579..2580) | - | , g | dbSNP:36090211 |
| Gene Symbol | C15orf29 |
| Gene Synonym | FLJ22557; MGC117356 |
| Chromosome | 15 |
| Locus Map | 15q14 |
| All Transcripts | NM_024713 |
| Title | Transcriptome analysis of human gastric cancer . |
| Author | Oh,J.H., Yang,J.O., Hahn,Y., Kim,M.R., Byun,S.S., Jeon,Y.J., Kim,J.M., Song,K.S., Noh,S.M., Kim,S., Yoo,H.S., Kim,Y.S. and Kim,N.S. |
| Journal | Mamm. Genome 16 (12), 942-954 (2005) |
| Title | Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing . |
| Author | Simpson,J.C., Wellenreuther,R., Poustka,A., Pepperkok,R. and Wiemann,S. |
| Journal | EMBO Rep. 1 (3), 287-292 (2000) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |