• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens katanin p80 subunit B-like 1 (KATNBL1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu04197 Homo sapiens katanin p80 subunit B-like 1 (KATNBL1), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu04197C Homo sapiens katanin p80 subunit B-like 1 (KATNBL1), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_024713.2, 194688139
Length 915 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens katanin p80 subunit B-like 1 (KATNBL1), mRNA.
Product KATNB1-like protein 1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK311338.1, AL136908.1, BX389537.2, BC026234.1 and BM831547.1. On Jul 30, 2008 this sequence version replaced gi:13376012.


##Evidence-Data-START## Transcript exon combination :: AL136908.1, AL833631.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END##

RefSeq NP_078989.1
CDS 161..1075
Misc Feature(1)152..154
Misc Feature(2)152..154
Misc Feature(3)602..1060
Misc Feature(4)602..1060
Exon (1)1..146
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (2)147..277
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (3)278..318
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (4)319..598
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (5)599..717
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (6)718..768
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (7)769..858
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (8)859..948
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (9)949..1042
Gene:KATNBL1
Gene Synonym:C15orf29
Exon (10)1043..2740
Gene:KATNBL1
Gene Synonym:C15orf29
Translation MASETHNVKKRNFCNKIEDHFIDLPRKKISNFTNKNMKEVKKSPKQLAAYINRTVGQTVK SPDKLRKVIYRRKKVHHPFPNPCYRKKQSPGSGGCDMANKENELACAGHLPEKLHHDSRT YLVNSSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNMRLNVALTFWRKRSISEL VAYLLRIEDLGVVVDCLPVLTNCLQEEKQYISLGCCVDLLPLVKSLLKSKFEEYVIVGLN WLQAVIKRWWSELSSKTEIINDGNIQILKQQLSGLWEQENHLTLVPGYTGNIAKDVDAYL LQLH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(23)-dbSNP:
complement(23)-g, cdbSNP:116356981
41+c, gdbSNP:17525806
45+a, tdbSNP:17525813
complement(63)-t, cdbSNP:2705106
complement(171)-t, gdbSNP:201043033
complement(178)-t, gdbSNP:372463446
complement(231)-c, adbSNP:372785233
complement(232)-c, adbSNP:367792067
complement(244)-g, cdbSNP:201524096
complement(258)-g, cdbSNP:76630379
complement(342)-dbSNP:
complement(342)-g, cdbSNP:199944929
complement(362)-g, cdbSNP:74617641
complement(369)-t, cdbSNP:375027107
complement(372)-t, cdbSNP:369840113
complement(394)-g, cdbSNP:112492109
complement(416)-t, cdbSNP:377447488
complement(426)-g, cdbSNP:371756125
complement(432)-c, adbSNP:148913855
complement(516)-t, cdbSNP:369374470
complement(536)-t, cdbSNP:145452916
complement(560)-g, cdbSNP:201663750
complement(593)-g, adbSNP:375825009
complement(623)-dbSNP:
complement(623)-c, adbSNP:144230292
complement(641)-t, cdbSNP:112452087
complement(689)-t, cdbSNP:140318237
complement(734)-dbSNP:
complement(734)-t, cdbSNP:369718128
complement(849)-dbSNP:
complement(849)-t, cdbSNP:139830158
complement(861)-dbSNP:
complement(861)-t, cdbSNP:150678561
complement(896)-t, cdbSNP:200538549
complement(904)-t, cdbSNP:112364992
complement(921)-g, adbSNP:186125698
complement(989)-dbSNP:
complement(989)-t, cdbSNP:34998154
complement(1008)-g, cdbSNP:192899081
complement(1069)-dbSNP:
complement(1069)-t, cdbSNP:148593495
complement(1103)-t, cdbSNP:183333529
complement(1120)-g, adbSNP:370751058
complement(1121)-g, cdbSNP:371892892
1128+a, gdbSNP:2339370
1147+, adbSNP:3028163
1237+a, gdbSNP:2339371
1271+a, gdbSNP:2339372
1314+a, tdbSNP:4041430
1343+a, gdbSNP:3964624
complement(1348)-t, cdbSNP:190390812
1479..1481+, tttdbSNP:4041431
complement(1508)-t, gdbSNP:78691728
complement(1573)-, tdbSNP:147044048
complement(1654)-t, gdbSNP:115094254
complement(1665..1666)-, tdbSNP:57764295
complement(1710)-t, gdbSNP:370852978
complement(1816)-g, adbSNP:146580412
complement(1848)-g, adbSNP:150023340
complement(1849)-t, g, adbSNP:8031204
complement(1995)-t, cdbSNP:139382345
complement(2004)-g, cdbSNP:150902114
complement(2230)-g, adbSNP:181832917
complement(2268)-t, cdbSNP:17817770
complement(2301)-t, adbSNP:55792000
complement(2316)-t, cdbSNP:189490422
complement(2322..2323)-, cdbSNP:35587676
complement(2324)-g, adbSNP:111810212
complement(2353)-t, cdbSNP:186080751
complement(2413)-t, cdbSNP:375449323
complement(2447)-t, cdbSNP:142474248
complement(2489)-g, adbSNP:180694029
complement(2530)-t, cdbSNP:189505560
complement(2554)-t, cdbSNP:140272493
complement(2579..2580)-, gdbSNP:36090211
complement(2618)-t, cdbSNP:370306689
Gene SymbolKATNBL1
Gene SynonymC15orf29
Chromosome15
Locus Map15q14
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_024713 Homo sapiens katanin p80 subunit B-like 1 (KATNBL1), mRNA. On-demand $159.00 7-9
NM_024713 Homo sapiens katanin p80 subunit B-like 1 (KATNBL1), mRNA. On-demand $159.00 7-9
NM_024713 Homo sapiens katanin p80 subunit B-like 1 (KATNBL1), mRNA. On-demand $159.00 7-9
NM_024713 Homo sapiens katanin p80 subunit B-like 1 (KATNBL1), mRNA. On-demand $159.00 7-9
NM_024713 Homo sapiens katanin p80 subunit B-like 1 (KATNBL1), mRNA. On-demand $159.00 7-9
Title The spindle assembly function of Caenorhabditis elegans katanin does not require microtubule-severing activity .
Author McNally KP and McNally FJ.
Journal Mol. Biol. Cell 22 (9), 1550-1560 (2011)
Title Transcriptome analysis of human gastric cancer .
Author Oh JH, Yang JO, Hahn Y, Kim MR, Byun SS, Jeon YJ, Kim JM, Song KS, Noh SM, Kim S, Yoo HS, Kim YS and Kim NS.
Journal Mamm. Genome 16 (12), 942-954 (2005)
Title Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing .
Author Simpson JC, Wellenreuther R, Poustka A, Pepperkok R and Wiemann S.
Journal EMBO Rep. 1 (3), 287-292 (2000)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.