• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_025219 Homo sapiens DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5), mRNA. GenEZ ORF Cloning On-demand $399.00 14

*Business Day

Related Services

RefSeq Version NM_025219.2, 313103004
Length 5307 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5), mRNA.
Product dnaJ homolog subfamily C member 5
Comment

Summary: This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. The encoded protein plays a role in membrane trafficking and protein folding, and has been shown to have anti-neurodegenerative properties. The encoded protein is known to play a role in cystic fibrosis and Huntington's disease. A pseudogene of this gene is located on the short arm of chromosome 8. [provided by RefSeq, Nov 2010].

RefSeq NP_079495.1
CDS 234..830
Misc Feature(1)225..227
Misc Feature(2)225..227
Misc Feature(3)255..257
Misc Feature(4)255..257
Misc Feature(5)261..263
Misc Feature(6)261..263
Misc Feature(7)261..263
Misc Feature(8)276..>485
Misc Feature(9)276..278
Misc Feature(10)282..440
Misc Feature(11)order(360..368,393..395,402..407,414..419)
Misc Feature(12)399..401
Exon (1)1..222
Gene:DNAJC5
Gene Synonym:CLN4; CLN4B; CSP; DNAJC5A; NCL
Exon (2)223..340
Gene:DNAJC5
Gene Synonym:CLN4; CLN4B; CSP; DNAJC5A; NCL
Exon (3)341..554
Gene:DNAJC5
Gene Synonym:CLN4; CLN4B; CSP; DNAJC5A; NCL
Exon (4)555..726
Gene:DNAJC5
Gene Synonym:CLN4; CLN4B; CSP; DNAJC5A; NCL
Exon (5)727..5293
Gene:DNAJC5
Gene Synonym:CLN4; CLN4B; CSP; DNAJC5A; NCL
Translation MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEI NNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVFCGLLTCCY CCCCLCCCFNCCCGKCKPKAPEGEETEFYVSPEDLEAQLQSDEREATDTPIVIQPASATE TTQLTADSHPSYHTDGFN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
250+a, gdbSNP:200104219
251+a, gdbSNP:148585496
278+a, gdbSNP:144141585
279+c, tdbSNP:371819808
308+c, tdbSNP:189308547
350+dbSNP:
350+c, gdbSNP:147295643
365+c, tdbSNP:140948457
377+c, tdbSNP:113987077
386+g, tdbSNP:151265913
393+a, gdbSNP:202015608
421+c, tdbSNP:139312819
429+a, gdbSNP:371863489
458+c, tdbSNP:376163421
461+c, tdbSNP:201495666
470+c, tdbSNP:149971662
515+c, tdbSNP:113207069
557+dbSNP:
557+c, gdbSNP:141103374
563+a, tdbSNP:370749414
577+g, tdbSNP:387907043
595+a, gdbSNP:200240375
603+g, tdbSNP:373850027
614+c, tdbSNP:199712884
632+c, tdbSNP:377198126
652+c, tdbSNP:144915847
681+g, tdbSNP:146719477
689+c, tdbSNP:140326040
719+c, tdbSNP:145468246
743+dbSNP:
743+g, tdbSNP:369508682
758+a, gdbSNP:373237152
760+c, tdbSNP:199540600
764+c, tdbSNP:376694698
798+c, tdbSNP:377119075
843+c, gdbSNP:370517092
988+a, tdbSNP:41278210
1025+a, gdbSNP:180676568
1104..1105+, cdbSNP:35725001
1152+a, gdbSNP:143646564
1186+a, gdbSNP:111986990
1203+a, gdbSNP:188304560
1298+c, gdbSNP:181187018
complement(1314)-c, adbSNP:148120785
1375+c, gdbSNP:373789837
1383+a, gdbSNP:141876407
1521+g, tdbSNP:185583381
1538+a, gdbSNP:190430622
1540+a, gdbSNP:373517080
1557+a, cdbSNP:75130625
1558+a, gdbSNP:150670642
1558+c, tdbSNP:386448010
1563+a, gdbSNP:370655221
complement(1580)-t, gdbSNP:140106848
1586+g, tdbSNP:374071727
1591+c, tdbSNP:182038156
1597+c, tdbSNP:200797893
1647+c, tdbSNP:114525694
1683+a, c, gdbSNP:6011230
1697+a, gdbSNP:142246799
1697+c, tdbSNP:386471987
1725+c, gdbSNP:1064345
1739+g, tdbSNP:114038171
1762+a, gdbSNP:3764726
1842+a, gdbSNP:111530162
1843+g, tdbSNP:374724029
1882+c, tdbSNP:41278212
1909+c, tdbSNP:370539010
1936+g, tdbSNP:11554629
2027+a, gdbSNP:187083695
2050+a, gdbSNP:73136582
2065+c, tdbSNP:149675982
2133+c, tdbSNP:41278214
2135+g, tdbSNP:41278216
2172+a, gdbSNP:41278218
2194+c, tdbSNP:61735744
2243+c, tdbSNP:375806163
2263+a, gdbSNP:41278220
2269+c, tdbSNP:192310826
2272+a, gdbSNP:61744085
complement(2304)-g, adbSNP:145450467
2356+a, cdbSNP:182388077
2386+a, gdbSNP:58526294
2426+a, gdbSNP:61740713
2473+c, tdbSNP:142546412
2478+c, tdbSNP:41278222
2479+a, gdbSNP:186759404
2502+c, tdbSNP:190043990
2650+a, cdbSNP:182604967
2716+g, tdbSNP:11554632
2720+c, tdbSNP:368351354
2757+a, gdbSNP:187307345
complement(2761)-t, cdbSNP:13048
2785+a, gdbSNP:192839202
2869+c, tdbSNP:79245733
2888+c, tdbSNP:376946085
2953+a, tdbSNP:369294707
2967+a, gdbSNP:368218060
3001+a, gdbSNP:185288496
3038+c, tdbSNP:11554631
3048+a, gdbSNP:142121195
3172+g, tdbSNP:7360045
3209+a, gdbSNP:6062590
3393+a, cdbSNP:188604040
complement(3399)-c, adbSNP:11224
3431+c, tdbSNP:112103063
3447+a, gdbSNP:6122217
3453..3454+, adbSNP:35892428
complement(3531)-g, adbSNP:3206771
3531+c, tdbSNP:386580784
3541+a, gdbSNP:76291580
3546..3550+, cctgtdbSNP:368523501
3553+a, gdbSNP:76769576
3555+a, gdbSNP:11554628
3569+a, gdbSNP:6122218
3591..3596+, tgctttdbSNP:111755454
3595..3600+, tttgctdbSNP:375427318
3620+c, tdbSNP:55665472
complement(3708)-g, adbSNP:749724
3729+a, gdbSNP:62218071
complement(3742)-g, adbSNP:749723
3842+c, tdbSNP:193241753
4014+a, gdbSNP:185738914
4034+c, tdbSNP:140377993
4035+a, gdbSNP:188065663
4243+a, gdbSNP:150408300
complement(4262)-g, adbSNP:1051821
4393+c, tdbSNP:138122310
4459+a, gdbSNP:73136585
4500+a, gdbSNP:77107548
4669+a, gdbSNP:145028189
4801+c, tdbSNP:369634697
4825+a, gdbSNP:115323539
4836+c, tdbSNP:138866062
4837+c, gdbSNP:77777268
4895+a, gdbSNP:373099874
4900+c, gdbSNP:3810500
4947+c, tdbSNP:11554630
4959+c, gdbSNP:191412647
4961+c, tdbSNP:146360147
4976+a, gdbSNP:1051865
5130+c, tdbSNP:41278224
5159+c, tdbSNP:370513858
5174+c, tdbSNP:369210127
5206+c, tdbSNP:183854692
5215+a, tdbSNP:77335831
5220+c, tdbSNP:368872154
5285+c, tdbSNP:74554553
Gene SymbolDNAJC5
Gene SynonymCLN4; CLN4B; CSP; DNAJC5A; NCL
Chromosome20
Locus Map20q13.33
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_025219 Homo sapiens DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5), mRNA. On-demand $399.00 14
Title Recurrent mutations in DNAJC5 cause autosomal dominant Kufs disease .
Author Cadieux-Dion M, Andermann E, Lachance-Touchette P, Ansorge O, Meloche C, Barnabe A, Kuzniecky RI, Andermann F, Faught E, Leonberg S, Damiano JA, Berkovic SF, Rouleau GA and Cossette P.
Journal Clin. Genet. 83 (6), 571-575 (2013)
Title Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array .
Author Eeles RA, Olama AA, Benlloch S, Saunders EJ, Leongamornlert DA, Tymrakiewicz M, Ghoussaini M, Luccarini C, Dennis J, Jugurnauth-Little S, Dadaev T, Neal DE, Hamdy FC, Donovan JL, Muir K, Giles GG, Severi G, Wiklund F, Gronberg H, Haiman CA, Schumacher F, Henderson BE, Le Marchand L, Lindstrom S, Kraft P, Hunter DJ, Gapstur S, Chanock SJ, Berndt SI, Albanes D, Andriole G, Schleutker J, Weischer M, Canzian F, Riboli E, Key TJ, Travis RC, Campa D, Ingles SA, John EM, Hayes RB, Pharoah PD, Pashayan N, Khaw KT, Stanford JL, Ostrander EA, Signorello LB, Thibodeau SN, Schaid D, Maier C, Vogel W, Kibel AS, Cybulski C, Lubinski J, Cannon-Albright L, Brenner H, Park JY, Kaneva R, Batra J, Spurdle AB, Clements JA, Teixeira MR, Dicks E, Lee A, Dunning AM, Baynes C, Conroy D, Maranian MJ, Ahmed S, Govindasami K, Guy M, Wilkinson RA, Sawyer EJ, Morgan A, Dearnaley DP, Horwich A, Huddart RA, Khoo VS, Parker CC, Van As NJ, Woodhouse CJ, Thompson A, Dudderidge T, Ogden C, Cooper CS, Lophatananon A, Cox A, Southey MC, Hopper JL, English DR, Aly M, Adolfsson J, Xu J, Zheng SL, Yeager M, Kaaks R, Diver WR, Gaudet MM, Stern MC, Corral R, Joshi AD, Shahabi A, Wahlfors T, Tammela TL, Auvinen A, Virtamo J, Klarskov P, Nordestgaard BG, Roder MA, Nielsen SF, Bojesen SE, Siddiq A, Fitzgerald LM, Kolb S, Kwon EM, Karyadi DM, Blot WJ, Zheng W, Cai Q, McDonnell SK, Rinckleb AE, Drake B, Colditz G, Wokolorczyk D, Stephenson RA, Teerlink C, Muller H, Rothenbacher D, Sellers TA, Lin HY, Slavov C, Mitev V, Lose F, Srinivasan S, Maia S, Paulo P, Lange E, Cooney KA, Antoniou AC, Vincent D, Bacot F, Tessier DC, Kote-Jarai Z and Easton DF.
Journal Nat. Genet. 45 (4), 385-391 (2013)
Title Palmitoylation-induced aggregation of cysteine-string protein mutants that cause neuronal ceroid lipofuscinosis .
Author Greaves J, Lemonidis K, Gorleku OA, Cruchaga C, Grefen C and Chamberlain LH.
Journal J. Biol. Chem. 287 (44), 37330-37339 (2012)
Title Mutations in the gene DNAJC5 cause autosomal dominant Kufs disease in a proportion of cases: study of the Parry family and 8 other families .
Author Velinov M, Dolzhanskaya N, Gonzalez M, Powell E, Konidari I, Hulme W, Staropoli JF, Xin W, Wen GY, Barone R, Coppel SH, Sims K, Brown
Journal PLoS ONE 7 (1), E29729 (2012)
Title CSPalpha: the neuroprotective J protein .
Author Johnson JN, Ahrendt E and Braun JE.
Journal Biochem. Cell Biol. 88 (2), 157-165 (2010)
Title Widespread expression of human cysteine string proteins .
Author Coppola T and Gundersen C.
Journal FEBS Lett. 391 (3), 269-272 (1996)
Title Neuronal Ceroid-Lipofuscinoses .
Author Mole,S.E. and Williams,R.E.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Dystonia Overview .
Author Klein,C., Marras,C. and Munchau,A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Adult neuronal ceroid-lipofuscinosis .
Author Goebel HH and Braak H.
Journal Clin. Neuropathol. 8 (3), 109-119 (1989)
Title Kufs' disease: a critical reappraisal .
Author Berkovic SF, Carpenter S, Andermann F, Andermann E and Wolfe LS.
Journal Brain 111 (PT 1), 27-62 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.