• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens programmed cell death 1 ligand 2 (PDCD1LG2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu04434 Homo sapiens programmed cell death 1 ligand 2 (PDCD1LG2), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu04434C Homo sapiens programmed cell death 1 ligand 2 (PDCD1LG2), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_025239.3, 190014604
Length 822 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens programmed cell death 1 ligand 2 (PDCD1LG2), mRNA.
Product programmed cell death 1 ligand 2 precursor
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AF344424.1, AF329193.1, BX951459.1, AK001872.1 and CA442083.1. On Jun 11, 2008 this sequence version replaced gi:31543389.

RefSeq NP_079515.2
CDS 274..1095
Misc Feature(1)178..180
Misc Feature(2)349..>582
Misc Feature(3)376..630
Misc Feature(4)682..852
Misc Feature(5)934..996
Exon (1)1..259
Gene:PDCD1LG2
Gene Synonym:B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Exon (2)260..328
Gene:PDCD1LG2
Gene Synonym:B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Exon (3)329..634
Gene:PDCD1LG2
Gene Synonym:B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Exon (4)635..904
Gene:PDCD1LG2
Gene Synonym:B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Exon (5)905..1039
Gene:PDCD1LG2
Gene Synonym:B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Exon (6)1040..1089
Gene:PDCD1LG2
Gene Synonym:B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Exon (7)1090..2418
Gene:PDCD1LG2
Gene Synonym:B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Translation MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQ KVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVK ASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVL RLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPTWLLHIFIPFCIIAFIFIATV IALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
57+dbSNP:
57+a, gdbSNP:74642789
74+a, gdbSNP:145695857
87+a, gdbSNP:36088486
100+a, gdbSNP:16923189
135+a, gdbSNP:386446184
135+c, tdbSNP:74491902
159+g, tdbSNP:191571737
198+a, gdbSNP:80027732
245+a, gdbSNP:184004376
260+dbSNP:
260+a, gdbSNP:199824030
262+a, cdbSNP:375761872
289+c, tdbSNP:370217715
293+c, tdbSNP:139799003
327+a, cdbSNP:372689058
346+dbSNP:
346+a, gdbSNP:117136501
355+g, tdbSNP:150821059
368+c, tdbSNP:369302753
370+c, gdbSNP:373326879
384+c, tdbSNP:376297615
401+a, gdbSNP:369468702
434+a, cdbSNP:78681414
436+a, cdbSNP:373050561
446+c, gdbSNP:12339171
446+c, gdbSNP:386471024
472+g, tdbSNP:376469981
482+a, gdbSNP:146192984
502+c, gdbSNP:61760970
508+c, gdbSNP:56072800
514+c, tdbSNP:61760971
531+a, gdbSNP:149917061
532+c, tdbSNP:144975887
541+c, tdbSNP:202158510
544+c, tdbSNP:376982371
561+c, tdbSNP:149087995
562+a, gdbSNP:201840318
598+a, gdbSNP:200938803
603+a, gdbSNP:142200330
658+dbSNP:
658+c, tdbSNP:199626246
670+g, tdbSNP:151227311
690+a, tdbSNP:371031746
697+a, gdbSNP:181034723
704+a, tdbSNP:200633476
745+a, gdbSNP:141466336
751+a, gdbSNP:146333130
763+a, cdbSNP:201453120
774+c, tdbSNP:56043856
780+c, tdbSNP:139076098
787+a, gdbSNP:186238681
807+a, tdbSNP:141602992
840+c, tdbSNP:12342703
854..855+, gdbSNP:34729364
867+a, cdbSNP:200925206
868+a, gdbSNP:138254251
886+a, gdbSNP:372985142
896+a, gdbSNP:111291501
905+dbSNP:
905+a, gdbSNP:368726477
938+g, tdbSNP:371424520
959+c, tdbSNP:7854303
964+a, gdbSNP:374102761
995+c, tdbSNP:7854413
1013+a, tdbSNP:139007200
1026+a, gdbSNP:368170363
1090+dbSNP:
1090+a, gdbSNP:142289553
1137+a, gdbSNP:369380473
1149+a, gdbSNP:374539843
1150+a, gdbSNP:200672658
1330+a, cdbSNP:150069126
1455+c, tdbSNP:371672787
1459+a, gdbSNP:187721785
1497+a, gdbSNP:190747810
1599+c, tdbSNP:114667484
1652+a, tdbSNP:147555183
1789..1790+, tdbSNP:370856497
1789+, tdbSNP:138221285
1790+g, tdbSNP:199621794
1840+c, gdbSNP:202238223
1913+a, cdbSNP:78150891
1960+c, tdbSNP:75093564
1986+c, tdbSNP:141977757
1986+, tdbSNP:35637615
2002+a, cdbSNP:144265357
2007+c, gdbSNP:182957048
2023+c, tdbSNP:116339877
2063+c, tdbSNP:187827685
2070+c, gdbSNP:192566024
2076+a, cdbSNP:184426180
2080+c, tdbSNP:73641643
2191+c, tdbSNP:187516413
2241+a, gdbSNP:41280729
2340+c, tdbSNP:192828600
2376+a, gdbSNP:371932568
2400+c, tdbSNP:375190927
Gene SymbolPDCD1LG2
Gene SynonymB7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Chromosome9
Locus Map9p24.2
Title [PD-L1/PD-L2 on human placenta-derived mesenchymal stem cells inhibits the IL-17 secretion of peripheral blood T cells] .
Author Wang G, Wang F, Li H, Zhang L and Luan X.
Journal Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi 29 (2), 132-136 (2013)
Title Intrahepatic expression of programmed death-1 and its ligands in patients with HBV-related acute-on-chronic liver failure .
Author Cao D, Xu H, Guo G, Ruan Z, Fei L, Xie Z, Wu Y and Chen Y.
Journal Inflammation 36 (1), 110-120 (2013)
Title Sex-associated expression of co-stimulatory molecules CD80, CD86, and accessory molecules, PDL-1, PDL-2 and MHC-II, in F480+ macrophages during murine cysticercosis .
Author Togno-Peirce C, Nava-Castro K, Terrazas LI and Morales-Montor J.
Journal Biomed Res Int 2013, 570158 (2013)
Title Immune suppression in premalignant respiratory papillomas: enriched functional CD4+Foxp3+ regulatory T cells and PD-1/PD-L1/L2 expression .
Author Hatam LJ, Devoti JA, Rosenthal DW, Lam F, Abramson AL, Steinberg BM and Bonagura VR.
Journal Clin. Cancer Res. 18 (7), 1925-1935 (2012)
Title Human brain endothelial cells endeavor to immunoregulate CD8 T cells via PD-1 ligand expression in multiple sclerosis .
Author Pittet CL, Newcombe J, Prat A and Arbour N.
Journal J Neuroinflammation 8, 155 (2011)
Title Preferential contribution of B7-H1 to programmed death-1-mediated regulation of hapten-specific allergic inflammatory responses .
Author Tsushima F, Iwai H, Otsuki N, Abe M, Hirose S, Yamazaki T, Akiba H, Yagita H, Takahashi Y, Omura K, Okumura K and Azuma M.
Journal Eur. J. Immunol. 33 (10), 2773-2782 (2003)
Title Differential binding properties of B7-H1 and B7-DC to programmed death-1 .
Author Youngnak P, Kozono Y, Kozono H, Iwai H, Otsuki N, Jin H, Omura K, Yagita H, Pardoll DM, Chen L and Azuma M.
Journal Biochem. Biophys. Res. Commun. 307 (3), 672-677 (2003)
Title Blockade of programmed death-1 ligands on dendritic cells enhances .
Author Brown JA, Dorfman DM, Ma FR, Sullivan EL, Munoz O, Wood CR, Greenfield EA and Freeman GJ.
Journal J. Immunol. 170 (3), 1257-1266 (2003)
Title B7-DC, a new dendritic cell molecule with potent costimulatory properties for T cells .
Author Tseng SY, Otsuji M, Gorski K, Huang X, Slansky JE, Pai SI, Shalabi A, Shin T, Pardoll DM and Tsuchiya H.
Journal J. Exp. Med. 193 (7), 839-846 (2001)
Title PD-L2 is a second ligand for PD-1 and inhibits T cell activation .
Author Latchman Y, Wood CR, Chernova T, Chaudhary D, Borde M, Chernova I, Iwai Y, Long AJ, Brown JA, Nunes R, Greenfield EA, Bourque K, Boussiotis VA, Carter LL, Carreno BM, Malenkovich N, Nishimura H, Okazaki T, Honjo T, Sharpe AH and Freeman GJ.
Journal Nat. Immunol. 2 (3), 261-268 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.