• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens programmed cell death 1 ligand 2 (PDCD1LG2), mRNA.


RefSeq Accession Definition Services Price Order
NM_025239 Homo sapiens programmed cell death 1 ligand 2 (PDCD1LG2), mRNA. ORF Sequence $238.38
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_025239.3, 190014604
Length 2418 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens programmed cell death 1 ligand 2 (PDCD1LG2), mRNA.
Product programmed cell death 1 ligand 2 precursor
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AF344424.1, AF329193.1, BX951459.1, AK001872.1 and CA442083.1. On Jun 11, 2008 this sequence version replaced gi:31543389.

RefSeq NP_079515.2
CDS 274..1095
Misc Feature(1)178..180
Misc Feature(2)376..630
Misc Feature(3)682..852
Misc Feature(4)934..996
Exon (1)1..259
Gene:PDCD1LG2
Gene Synonym:B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Exon (2)260..328
Gene:PDCD1LG2
Gene Synonym:B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Exon (3)329..634
Gene:PDCD1LG2
Gene Synonym:B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Exon (4)635..904
Gene:PDCD1LG2
Gene Synonym:B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Exon (5)905..1039
Gene:PDCD1LG2
Gene Synonym:B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Exon (6)1040..1089
Gene:PDCD1LG2
Gene Synonym:B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Exon (7)1090..2418
Gene:PDCD1LG2
Gene Synonym:B7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Translation MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQ KVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVK ASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVL RLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPTWLLHIFIPFCIIAFIFIATV IALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
57+dbSNP:
57+a, gdbSNP:74642789
74+a, gdbSNP:145695857
87+a, gdbSNP:36088486
100+a, gdbSNP:16923189
135+c, tdbSNP:74491902
159+g, tdbSNP:191571737
198+a, gdbSNP:80027732
245+a, gdbSNP:184004376
260+dbSNP:
260+a, gdbSNP:199824030
293+c, tdbSNP:139799003
346+dbSNP:
346+a, gdbSNP:117136501
355+g, tdbSNP:150821059
434+a, cdbSNP:78681414
446+c, gdbSNP:12339171
482+a, gdbSNP:146192984
502+c, gdbSNP:61760970
508+c, gdbSNP:56072800
514+c, tdbSNP:61760971
531+a, gdbSNP:149917061
532+c, tdbSNP:144975887
541+c, tdbSNP:202158510
561+c, tdbSNP:149087995
562+a, gdbSNP:201840318
598+a, gdbSNP:200938803
603+a, gdbSNP:142200330
658+dbSNP:
658+c, tdbSNP:199626246
670+g, tdbSNP:151227311
697+a, gdbSNP:181034723
704+a, tdbSNP:200633476
745+a, gdbSNP:141466336
751+a, gdbSNP:146333130
763+a, cdbSNP:201453120
774+c, tdbSNP:56043856
780+c, tdbSNP:139076098
787+a, gdbSNP:186238681
807+a, tdbSNP:141602992
840+c, tdbSNP:12342703
854..855+, gdbSNP:34729364
867+a, cdbSNP:200925206
868+a, gdbSNP:138254251
896+a, gdbSNP:111291501
959+dbSNP:
959+c, tdbSNP:7854303
995+c, tdbSNP:7854413
1013+a, tdbSNP:139007200
1090+dbSNP:
1090+a, gdbSNP:142289553
1150+a, gdbSNP:200672658
1330+a, cdbSNP:150069126
1459+a, gdbSNP:187721785
1497+a, gdbSNP:190747810
1599+c, tdbSNP:114667484
1652+a, tdbSNP:147555183
1780+, tdbSNP:138221285
1790+g, tdbSNP:199621794
1840+c, gdbSNP:202238223
1913+a, cdbSNP:78150891
1960+c, tdbSNP:75093564
1983+, tdbSNP:35637615
1986+c, tdbSNP:141977757
2002+a, cdbSNP:144265357
2007+c, gdbSNP:182957048
2023+c, tdbSNP:116339877
2063+c, tdbSNP:187827685
2070+c, gdbSNP:192566024
2076+a, cdbSNP:184426180
2080+c, tdbSNP:73641643
2191+c, tdbSNP:187516413
2241+a, gdbSNP:41280729
2340+c, tdbSNP:192828600
Gene SymbolPDCD1LG2
Gene SynonymB7DC; bA574F11.2; Btdc; CD273; PD-L2; PDCD1L2; PDL2
Chromosome9
Locus Map9p24.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_025239 Homo sapiens programmed cell death 1 ligand 2 (PDCD1LG2), mRNA. Full Length $701.22
ORF Sequence $238.38
Title Immune suppression in premalignant respiratory papillomas: enriched functional CD4+Foxp3+ regulatory T cells and PD-1/PD-L1/L2 expression .
Author Hatam,L.J., Devoti,J.A., Rosenthal,D.W., Lam,F., Abramson,A.L., Steinberg,B.M. and Bonagura,V.R.
Journal Clin. Cancer Res. 18 (7), 1925-1935 (2012)
Title Effects of genetic polymorphisms of programmed cell death 1 and its ligands on the development of ankylosing spondylitis .
Author Huang,C.H., Wong,R.H., Wei,J.C., Tsay,M.D., Chen,W.C., Chen,H.Y., Shih,W.T., Chiou,S.P., Tu,Y.C. and Lee,H.S.
Journal Rheumatology (Oxford) 50 (10), 1809-1813 (2011)
Title PD-L2 is expressed on activated human T cells and regulates their function .
Author Messal,N., Serriari,N.E., Pastor,S., Nunes,J.A. and Olive,D.
Journal Mol. Immunol. 48 (15-16), 2214-2219 (2011)
Title Immunostaining of PD-1/PD-Ls in liver tissues of patients with hepatitis and hepatocellular carcinoma .
Author Wang,B.J., Bao,J.J., Wang,J.Z., Wang,Y., Jiang,M., Xing,M.Y., Zhang,W.G., Qi,J.Y., Roggendorf,M., Lu,M.J. and Yang,D.L.
Journal World J. Gastroenterol. 17 (28), 3322-3329 (2011)
Title Human brain endothelial cells endeavor to immunoregulate CD8 T cells via PD-1 ligand expression in multiple sclerosis .
Author Pittet,C.L., Newcombe,J., Prat,A. and Arbour,N.
Journal J Neuroinflammation 8, 155 (2011)
Title Preferential contribution of B7-H1 to programmed death-1-mediated regulation of hapten-specific allergic inflammatory responses .
Author Tsushima,F., Iwai,H., Otsuki,N., Abe,M., Hirose,S., Yamazaki,T., Akiba,H., Yagita,H., Takahashi,Y., Omura,K., Okumura,K. and Azuma,M.
Journal Eur. J. Immunol. 33 (10), 2773-2782 (2003)
Title Differential binding properties of B7-H1 and B7-DC to programmed death-1 .
Author Youngnak,P., Kozono,Y., Kozono,H., Iwai,H., Otsuki,N., Jin,H., Omura,K., Yagita,H., Pardoll,D.M., Chen,L. and Azuma,M.
Journal Biochem. Biophys. Res. Commun. 307 (3), 672-677 (2003)
Title Blockade of programmed death-1 ligands on dendritic cells enhances .
Author Brown,J.A., Dorfman,D.M., Ma,F.R., Sullivan,E.L., Munoz,O., Wood,C.R., Greenfield,E.A. and Freeman,G.J.
Journal J. Immunol. 170 (3), 1257-1266 (2003)
Title B7-DC, a new dendritic cell molecule with potent costimulatory properties for T cells .
Author Tseng,S.Y., Otsuji,M., Gorski,K., Huang,X., Slansky,J.E., Pai,S.I., Shalabi,A., Shin,T., Pardoll,D.M. and Tsuchiya,H.
Journal J. Exp. Med. 193 (7), 839-846 (2001)
Title PD-L2 is a second ligand for PD-1 and inhibits T cell activation .
Author Latchman,Y., Wood,C.R., Chernova,T., Chaudhary,D., Borde,M., Chernova,I., Iwai,Y., Long,A.J., Brown,J.A., Nunes,R., Greenfield,E.A., Bourque,K., Boussiotis,V.A., Carter,L.L., Carreno,B.M., Malenkovich,N., Nishimura,H., Okazaki,T., Honjo,T., Sharpe,A.H. and Freeman,G.J.
Journal Nat. Immunol. 2 (3), 261-268 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878