• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens high mobility group nucleosome binding domain 5 (HMGN5), mRNA.


RefSeq Accession Definition Services Price Order
NM_030763 Homo sapiens high mobility group nucleosome binding domain 5 (HMGN5), mRNA. ORF Sequence $246.21
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_030763.2, 254028191
Length 2126 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens high mobility group nucleosome binding domain 5 (HMGN5), mRNA.
Product high mobility group nucleosome-binding domain-containing protein 5
Comment

Summary: This gene encodes a nuclear protein with similarities to the high mobility group proteins, HMG14 and HMG17, which suggests that this protein may function as a nucleosomal binding and transcriptional activating protein. [provided by RefSeq, Sep 2009].


##Evidence-Data-START## Transcript exon combination :: AK094058.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_110390.1
CDS 330..1178
Misc Feature(1)315..317
Misc Feature(2)315..317
Misc Feature(3)333..608
Misc Feature(4)333..608
Misc Feature(5)420..422
Misc Feature(6)555..557
Misc Feature(7)555..557
Exon (1)1..206
Gene:HMGN5
Gene Synonym:NBP-45; NSBP1
Exon (2)207..344
Gene:HMGN5
Gene Synonym:NBP-45; NSBP1
Exon (3)345..374
Gene:HMGN5
Gene Synonym:NBP-45; NSBP1
Exon (4)375..404
Gene:HMGN5
Gene Synonym:NBP-45; NSBP1
Exon (5)405..458
Gene:HMGN5
Gene Synonym:NBP-45; NSBP1
Exon (6)459..596
Gene:HMGN5
Gene Synonym:NBP-45; NSBP1
Exon (7)597..2126
Gene:HMGN5
Gene Synonym:NBP-45; NSBP1
Translation MPKRKAAGQGDMRQEPKRRSARLSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSA QAVAETKQEAVVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVA AEVKNEEEDQKEDEEDQNEEKGEAGKEDKDEKGEEDGKEDKNGNEKGEDAKEKEDGKKGE DGKGNGEDGKEKGEDEKEEEDRKETGDGKENEDGKEKGDKKEGKDVKVKEDEKEREDGKE DEGGNEEEAGKEKEDLKEEEEGKEEDEIKEDDGKKEEPQSIV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(352)-dbSNP:
complement(352)-c, adbSNP:142173136
complement(364)-g, adbSNP:138950278
complement(408)-dbSNP:
complement(408)-g, adbSNP:73631719
complement(428)-t, cdbSNP:73231013
complement(531)-dbSNP:
complement(531)-t, gdbSNP:148090107
complement(613..614)-dbSNP:
complement(613..614)-, tdbSNP:59584935
complement(658)-t, cdbSNP:143679569
complement(696)-t, cdbSNP:148928737
complement(794)-t, gdbSNP:147858164
complement(824)-g, cdbSNP:144502161
complement(840)-t, cdbSNP:142186197
complement(957)-g, cdbSNP:150302618
complement(994)-t, cdbSNP:149905720
complement(1075)-g, adbSNP:186732408
complement(1162)-g, adbSNP:41310713
complement(1333)-t, cdbSNP:184579787
complement(1351)-c, adbSNP:41300251
complement(1492)-t, gdbSNP:41300259
complement(1698)-, adbSNP:68183777
complement(2033)-c, adbSNP:148228755
complement(2036)-, adbSNP:199672193
Gene SymbolHMGN5
Gene SynonymNBP-45; NSBP1
ChromosomeX
Locus MapXq13.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_030763 Homo sapiens high mobility group nucleosome binding domain 5 (HMGN5), mRNA. Full Length $616.54
ORF Sequence $246.21
Title Small interfering RNA targeting HMGN5 induces apoptosis via modulation of a mitochondrial pathway and Bcl-2 family proteins in prostate cancer cells .
Author Zhang,X.Y., Guo,Z.Q., Ji,S.Q., Zhang,M., Jiang,N., Li,X.S. and Zhou,L.Q.
Journal Asian J. Androl. 14 (3), 487-492 (2012)
Title Knockdown of the nucleosome binding protein 1 inhibits the growth and invasion of clear cell renal cell carcinoma cells in vitro and in vivo .
Author Ji,S.Q., Yao,L., Zhang,X.Y., Li,X.S. and Zhou,L.Q.
Journal J. Exp. Clin. Cancer Res. 31, 22 (2012)
Title The nucleosome binding protein NSBP1 is highly expressed in human bladder cancer and promotes the proliferation and invasion of bladder cancer cells .
Author Wahafu,W., He,Z.S., Zhang,X.Y., Zhang,C.J., Yao,K., Hao,H., Song,G., He,Q., Li,X.S. and Zhou,L.Q.
Journal Tumour Biol. 32 (5), 931-939 (2011)
Title HMGN5: a potential oncogene in gliomas .
Author Qu,J., Yan,R., Chen,J., Xu,T., Zhou,J., Wang,M., Chen,C., Yan,Y. and Lu,Y.
Journal J. Neurooncol. 104 (3), 729-736 (2011)
Title Distinct properties of human HMGN5 reveal a rapidly evolving but functionally conserved nucleosome binding protein .
Author Malicet,C., Rochman,M., Postnikov,Y. and Bustin,M.
Journal Mol. Cell. Biol. 31 (13), 2742-2755 (2011)
Title Downregulation of the nucleosome-binding protein 1 (NSBP1) gene can inhibit the in vitro and in vivo proliferation of prostate cancer cells .
Author Jiang,N., Zhou,L.Q. and Zhang,X.Y.
Journal Asian J. Androl. 12 (5), 709-717 (2010)
Title HMGN5/NSBP1: a new member of the HMGN protein family that affects chromatin structure and function .
Author Rochman,M., Malicet,C. and Bustin,M.
Journal Biochim. Biophys. Acta 1799 (1-2), 86-92 (2010)
Title The interaction of NSBP1/HMGN5 with nucleosomes in euchromatin counteracts linker histone-mediated chromatin compaction and modulates transcription .
Author Rochman,M., Postnikov,Y., Correll,S., Malicet,C., Wincovitch,S., Karpova,T.S., McNally,J.G., Wu,X., Bubunenko,N.A., Grigoryev,S. and Bustin,M.
Journal Mol. Cell 35 (5), 642-656 (2009)
Title Immunoaffinity profiling of tyrosine phosphorylation in cancer cells .
Author Rush,J., Moritz,A., Lee,K.A., Guo,A., Goss,V.L., Spek,E.J., Zhang,H., Zha,X.M., Polakiewicz,R.D. and Comb,M.J.
Journal Nat. Biotechnol. 23 (1), 94-101 (2005)
Title Characterization of a human gene encoding nucleosomal binding protein NSBP1 .
Author King,L.M. and Francomano,C.A.
Journal Genomics 71 (2), 163-173 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878