• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 10 (SLC2A10), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_030777 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 10 (SLC2A10), mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_030777.3, 39777591
Length 4241 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 10 (SLC2A10), mRNA.
Product solute carrier family 2, facilitated glucose transporter member 10
Comment

Summary: This gene encodes a member of the class III facilitative glucose transporter family. The encoded protein plays a role in regulation of glucose homeostasis. Mutations in this gene have been associated with arterial tortuosity syndrome.[provided by RefSeq, Dec 2009].

RefSeq NP_110404.1
CDS 98..1723
Misc Feature(1)107..1621
Misc Feature(2)107..1621
Misc Feature(3)137..1588
Misc Feature(4)143..205
Misc Feature(5)order(173..175,182..190,194..199,248..250,257..262,
Misc Feature(6)242..304
Misc Feature(7)329..391
Misc Feature(8)416..478
Misc Feature(9)500..562
Misc Feature(10)596..658
Misc Feature(11)797..859
Misc Feature(12)905..967
Misc Feature(13)992..1054
Misc Feature(14)1340..1402
Misc Feature(15)1433..1495
Misc Feature(16)1526..1588
Exon (1)1..101
Gene:SLC2A10
Gene Synonym:ATS; GLUT10
Exon (2)102..1385
Gene:SLC2A10
Gene Synonym:ATS; GLUT10
Exon (3)1386..1508
Gene:SLC2A10
Gene Synonym:ATS; GLUT10
Exon (4)1509..1644
Gene:SLC2A10
Gene Synonym:ATS; GLUT10
Exon (5)1645..4236
Gene:SLC2A10
Gene Synonym:ATS; GLUT10
Translation MGHSPPVLPLCASVSLLGGLTFGYELAVISGALLPLQLDFGLSCLEQEFLVGSLLLGALL ASLVGGFLIDCYGRKQAILGSNLVLLAGSLTLGLAGSLAWLVLGRAVVGFAISLSSMACC IYVSELVGPRQRGVLVSLYEAGITVGILLSYALNYALAGTPWGWRHMFGWATAPAVLQSL SLLFLPAGTDETATHKDLIPLQGGEAPKLGPGRPRYSFLDLFRARDNMRGRTTVGLGLVL FQQLTGQPNVLCYASTIFSSVGFHGGSSAVLASVGLGAVKVAATLTAMGLVDRAGRRALL LAGCALMALSVSGIGLVSFAVPMDSGPSCLAVPNATGQTGLPGDSGLLQDSSLPPIPRTN EDQREPILSTAKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFV SAFSFGFGPVTWLVLSEIYPVEIRGRAFAFCNSFNWAANLFISLSFLDLIGTIGLSWTFL LYGLTAVLGLGFIYLFVPETKGQSLAEIDQQFQKRRFTLSFGHRQNSTGIPYSRIEISAA S
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
71+dbSNP:
71+a, gdbSNP:386481590
71+c, tdbSNP:149481442
83+c, tdbSNP:377142129
212+dbSNP:
212+a, gdbSNP:367623970
216+c, tdbSNP:372166877
217+c, tdbSNP:202176956
241+g, tdbSNP:375145963
267+g, tdbSNP:369796310
270+c, tdbSNP:141310869
277+c, tdbSNP:371988251
309+g, tdbSNP:377305511
334+a, cdbSNP:201323237
335+a, gdbSNP:369865870
340+c, gdbSNP:80358230
412+c, tdbSNP:150800734
413+g, tdbSNP:6094438
414+c, gdbSNP:144095826
419+a, gdbSNP:373375540
427+c, tdbSNP:199848479
463+a, gdbSNP:34990188
479+a, gdbSNP:373374576
485+c, tdbSNP:201150247
491+c, tdbSNP:121908173
492+a, gdbSNP:376346077
513+a, gdbSNP:139858464
529+c, tdbSNP:371344477
602+a, gdbSNP:35151194
607+a, gdbSNP:80358229
612+c, tdbSNP:143301610
635+c, tdbSNP:200595129
659+c, gdbSNP:374246708
665+g, tdbSNP:376504475
684+a, tdbSNP:145446653
696+c, gdbSNP:75218052
698+c, tdbSNP:199861432
706+a, gdbSNP:374470112
713+a, gdbSNP:2235491
727+c, tdbSNP:142431229
729+c, tdbSNP:151324893
740+c, tdbSNP:200565780
742+c, gdbSNP:367742782
744+a, gdbSNP:111525892
755+g, tdbSNP:141897744
766+a, gdbSNP:147083578
768+c, gdbSNP:371261694
770+c, tdbSNP:199659394
771+c, tdbSNP:34295241
773+a, gdbSNP:142402955
778+a, cdbSNP:201625851
788+c, tdbSNP:146579504
793+c, gdbSNP:138679634
794+a, gdbSNP:190252962
817+a, cdbSNP:374985824
819+g, tdbSNP:377745566
844+c, tdbSNP:41283042
856+c, tdbSNP:112973941
862+c, tdbSNP:142106322
877+c, tdbSNP:181500247
878+a, gdbSNP:372561968
889+c, tdbSNP:377031320
894+g, tdbSNP:369484751
904+c, tdbSNP:144705080
910+c, gdbSNP:372800860
913+c, gdbSNP:148058006
928+c, tdbSNP:142697617
945+a, cdbSNP:145994112
1012+c, tdbSNP:199975775
1021+c, tdbSNP:377173165
1028+a, gdbSNP:139932041
1047+c, tdbSNP:113404822
1050+a, gdbSNP:143235900
1057+c, tdbSNP:369162285
1058+a, gdbSNP:372596900
1099+a, tdbSNP:377238665
1103+a, gdbSNP:113828882
1105+c, tdbSNP:370173604
1106+a, gdbSNP:369238826
1107+c, gdbSNP:150745395
1111+c, gdbSNP:35833600
1154+c, g, tdbSNP:200196034
1176+a, gdbSNP:139117495
1202+a, tdbSNP:149874933
1211+a, gdbSNP:376258756
1236+a, cdbSNP:144909845
1251+c, gdbSNP:79849424
1259+c, tdbSNP:374891798
1282+c, tdbSNP:371752807
1294+a, tdbSNP:145683930
1300+c, tdbSNP:368021257
1301+a, gdbSNP:147710229
1305+a, c, gdbSNP:199912561
1309+g, tdbSNP:139155480
1350+c, tdbSNP:376711500
1373+g, tdbSNP:121908172
1402+dbSNP:
1402+c, tdbSNP:201159437
1421+c, gdbSNP:143265363
1427+c, tdbSNP:370547023
1428+a, gdbSNP:148324236
1435+a, tdbSNP:34605643
1448+g, tdbSNP:199599532
1466+a, gdbSNP:140520920
1467+c, tdbSNP:201393026
1519+dbSNP:
1519+c, gdbSNP:369038923
1522+g, tdbSNP:78125393
1524+a, cdbSNP:372876882
1543+c, tdbSNP:150398871
1550+a, gdbSNP:138245283
1561+c, tdbSNP:142639587
1562+c, gdbSNP:201268555
1578+a, gdbSNP:374854180
1609+a, gdbSNP:117587497
1638+a, gdbSNP:41283344
1645+dbSNP:
1645+g, tdbSNP:116344406
1649+a, gdbSNP:6018008
1668+a, gdbSNP:370141550
1690+a, gdbSNP:148424607
1697+c, tdbSNP:142577271
1702+c, tdbSNP:148470005
1706+a, gdbSNP:7348121
1713+c, tdbSNP:140312420
1714+a, gdbSNP:114974138
1717+c, tdbSNP:6094446
1719+c, tdbSNP:375600279
1720+c, tdbSNP:6094447
1730+c, tdbSNP:184333910
1731+a, gdbSNP:375282462
1735+a, gdbSNP:367978359
1740..1741+, gdbSNP:35087171
1752+c, gdbSNP:34965637
1755+c, tdbSNP:78864327
1769+c, tdbSNP:368911485
1773+c, tdbSNP:36103903
1779+a, gdbSNP:112821000
1782+c, tdbSNP:6094448
1789+c, tdbSNP:6094449
1839+c, tdbSNP:377528530
1843+, adbSNP:146327762
1866+a, gdbSNP:35691491
1883+c, tdbSNP:140516846
1899+c, tdbSNP:373092408
1903+a, gdbSNP:188370349
1917+g, tdbSNP:192739192
1991+, adbSNP:113206025
2001+g, tdbSNP:184782990
2003+c, tdbSNP:6018009
2057+a, gdbSNP:6018010
complement(2070)-g, adbSNP:145426891
2112+c, gdbSNP:147684335
2124+a, cdbSNP:142547155
2133+a, cdbSNP:146660985
2183..2184+, tdbSNP:373332520
2184+, tdbSNP:3091691
2193..2195+, tttdbSNP:11086178
2195+, tdbSNP:397794374
2201+a, gdbSNP:113058599
2236+c, tdbSNP:111352987
2239+c, tdbSNP:62214437
2305+a, cdbSNP:189086878
2364+a, gdbSNP:113629687
2400+a, gdbSNP:373915553
2413+c, tdbSNP:6066055
2449+g, tdbSNP:181469965
2532+c, tdbSNP:114681513
2680+a, gdbSNP:185087835
2681+c, tdbSNP:189464814
2682..2683+, ggadbSNP:141383370
2820+a, gdbSNP:11541582
2823+g, tdbSNP:6094450
2881+a, gdbSNP:181016330
2885+c, tdbSNP:185898725
2899+c, tdbSNP:112767614
2940+a, gdbSNP:189311786
3016+c, tdbSNP:707507
complement(3063)-g, adbSNP:78189695
3073+g, tdbSNP:9046
3172+c, tdbSNP:181344940
3190+a, tdbSNP:186295842
3240+a, gdbSNP:373757322
3392+a, gdbSNP:190526569
3441+c, tdbSNP:6066056
3457+a, gdbSNP:370448359
3467+c, tdbSNP:6066057
3531+c, tdbSNP:182856926
3736+a, gdbSNP:11086179
3760+a, cdbSNP:374118520
complement(3845)-g, adbSNP:145974990
3873+a, cdbSNP:6012025
3899+c, tdbSNP:1059217
3959+a, gdbSNP:55989302
3965..3966+, adbSNP:201588506
4007+a, gdbSNP:186443949
4008+g, tdbSNP:1136540
4025..4040+, ataaagaatatttacadbSNP:146488401
4038+a, cdbSNP:34912587
4088+a, tdbSNP:1136544
4233+c, tdbSNP:190803468
Gene SymbolSLC2A10
Gene SynonymATS; GLUT10
Chromosome20
Locus Map20q13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_030777 Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 10 (SLC2A10), mRNA. On-demand $699.00 18
XM_006723879 PREDICTED: Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 10 (SLC2A10), transcript variant X1, mRNA. On-demand $699.00 18
XM_006723880 PREDICTED: Homo sapiens solute carrier family 2 (facilitated glucose transporter), member 10 (SLC2A10), transcript variant X2, mRNA. On-demand $699.00 18
Title Rapid detection of gene mutations responsible for non-syndromic aortic aneurysm and dissection using two different methods: resequencing microarray technology and next-generation sequencing .
Author Sakai H, Suzuki S, Mizuguchi T, Imoto K, Yamashita Y, Doi H, Kikuchi M, Tsurusaki Y, Saitsu H, Miyake N, Masuda M and Matsumoto N.
Journal Hum. Genet. 131 (4), 591-599 (2012)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey SD, Xie C, Do R, Montpetit A, Diaz R, Mohan V, Keavney B, Yusuf S, Gerstein HC, Engert JC and Anand S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title SLC2A10 genetic polymorphism predicts development of peripheral arterial disease in patients with type 2 diabetes. SLC2A10 and PAD in type 2 diabetes .
Author Jiang YD, Chang YC, Chiu YF, Chang TJ, Li HY, Lin WH, Yuan HY, Chen
Journal BMC Med. Genet. 11, 126 (2010)
Title Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip .
Author Talmud PJ, Drenos F, Shah S, Shah T, Palmen J, Verzilli C, Gaunt TR, Pallas J, Lovering R, Li K, Casas JP, Sofat R, Kumari M, Rodriguez S, Johnson T, Newhouse SJ, Dominiczak A, Samani NJ, Caulfield M, Sever P, Stanton A, Shields DC, Padmanabhan S, Melander O, Hastie C, Delles C, Ebrahim S, Marmot MG, Smith GD, Lawlor DA, Munroe PB, Day IN, Kivimaki M, Whittaker J, Humphries SE and Hingorani AD.
Journal Am. J. Hum. Genet. 85 (5), 628-642 (2009)
Title Functional characterization of the promoter of the human glucose transporter 10 gene .
Author Segade F, Allred DC and Bowden DW.
Journal Biochim. Biophys. Acta 1730 (2), 147-158 (2005)
Title A family exhibiting arterial tortuosity syndrome displays homozygosity for markers in the arterial tortuosity locus at chromosome 20q13 .
Author Zaidi SH, Peltekova V, Meyer S, Lindinger A, Paterson AD, Tsui LC, Faiyaz-Ul-Haque M and Teebi AS.
Journal Clin. Genet. 67 (2), 183-188 (2005)
Title Expression of Class III facilitative glucose transporter genes (GLUT-10 and GLUT-12) in mouse and human adipose tissues .
Author Wood IS, Hunter L and Trayhurn P.
Journal Biochem. Biophys. Res. Commun. 308 (1), 43-49 (2003)
Title Molecular characterization and partial cDNA cloning of facilitative glucose transporters expressed in human articular chondrocytes; stimulation of 2-deoxyglucose uptake by IGF-I and elevated MMP-2 secretion by glucose deprivation .
Author Richardson S, Neama G, Phillips T, Bell S, Carter SD, Moley KH, Moley JF, Vannucci SJ and Mobasheri A.
Journal Osteoarthr. Cartil. 11 (2), 92-101 (2003)
Title Sequence and functional analysis of GLUT10: a glucose transporter in the Type 2 diabetes-linked region of chromosome 20q12-13.1 .
Author Dawson PA, Mychaleckyj JC, Fossey SC, Mihic SJ, Craddock AL and Bowden DW.
Journal Mol. Genet. Metab. 74 (1-2), 186-199 (2001)
Title Molecular cloning of a novel member of the GLUT family of transporters, SLC2a10 (GLUT10), localized on chromosome 20q13.1: a candidate gene for NIDDM susceptibility .
Author McVie-Wylie AJ, Lamson DR and Chen YT.
Journal Genomics 72 (1), 113-117 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.