• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens phosphatase and actin regulator 1 (PHACTR1), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_030948 Homo sapiens phosphatase and actin regulator 1 (PHACTR1), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_030948.2, 336391123
Length 2896 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens phosphatase and actin regulator 1 (PHACTR1), transcript variant 1, mRNA.
Product phosphatase and actin regulator 1
Comment

COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from DA330657.1, DA253448.1, BC101526.1, AL008729.1 and AA809685.1. On Jun 18, 2011 this sequence version replaced gi:54144630.


Transcript Variant: This variant (1) represents the longer transcript. Both variants 1 and 2 encode the same protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_112210.1
CDS 374..2116
Misc Feature(1)296..298
Misc Feature(2)695..760
Misc Feature(3)695..760
Misc Feature(4)785..862
Misc Feature(5)791..856
Misc Feature(6)1637..1714
Misc Feature(7)1637..1714
Misc Feature(8)1751..1825
Misc Feature(9)1754..1828
Misc Feature(10)1865..1942
Misc Feature(11)1865..1942
Exon (1)1..92
Gene:PHACTR1
Gene Synonym:dJ257A7.2; RPEL; RPEL1
Exon (2)93..327
Gene:PHACTR1
Gene Synonym:dJ257A7.2; RPEL; RPEL1
Exon (3)328..476
Gene:PHACTR1
Gene Synonym:dJ257A7.2; RPEL; RPEL1
Exon (4)477..623
Gene:PHACTR1
Gene Synonym:dJ257A7.2; RPEL; RPEL1
Exon (5)624..788
Gene:PHACTR1
Gene Synonym:dJ257A7.2; RPEL; RPEL1
Exon (6)789..869
Gene:PHACTR1
Gene Synonym:dJ257A7.2; RPEL; RPEL1
Exon (7)870..1037
Gene:PHACTR1
Gene Synonym:dJ257A7.2; RPEL; RPEL1
Exon (8)1038..1359
Gene:PHACTR1
Gene Synonym:dJ257A7.2; RPEL; RPEL1
Exon (9)1360..1607
Gene:PHACTR1
Gene Synonym:dJ257A7.2; RPEL; RPEL1
Exon (10)1608..1764
Gene:PHACTR1
Gene Synonym:dJ257A7.2; RPEL; RPEL1
Exon (11)1765..1820
Gene:PHACTR1
Gene Synonym:dJ257A7.2; RPEL; RPEL1
Exon (12)1821..1882
Gene:PHACTR1
Gene Synonym:dJ257A7.2; RPEL; RPEL1
Exon (13)1883..2023
Gene:PHACTR1
Gene Synonym:dJ257A7.2; RPEL; RPEL1
Exon (14)2024..2100
Gene:PHACTR1
Gene Synonym:dJ257A7.2; RPEL; RPEL1
Exon (15)2101..2881
Gene:PHACTR1
Gene Synonym:dJ257A7.2; RPEL; RPEL1
Translation MDYPKMDYFLDVESAHRLLDVESAQRFFYSQGAQARRATLLLPPTLMAASSEDDIDRRPI RRVRSKSDTPYLAEARISFNLGAAEEVERLAAMRSDSLVPGTHTPPIRRRSKFANLGRIF KPWKWRKKKSEKFKHTSAALERKISMRQSREELIKRGVLKEIYDKDGELSISNEEDSLEN GQSLSSSQLSLPALSEMEPVPMPRDPCSYEVLQPSDIMDGPDPGAPVKLPCLPVKLSPPL PPKKVMICMPVGGPDLSLVSYTAQKSGQQGVAQHHHTVLPSQIQHQLQYGSHGQHLPSTT GSLPMHPSGCRMIDELNKTLAMTMQRLESSEQRVPCSTSYHSSGLHSGDGVTKAGPMGLP EIRQVPTVVIECDDNKENVPHESDYEDSSCLYTREEEEEEEDEDDDSSLYTSSLAMKVCR KDSLAIKLSNRPSKRELEEKNILPRQTDEERLELRQQIGTKLTRRLSQRPTAEELEQRNI LKPRNEQEEQEEKREIKRRLTRKLSQRPTVEELRERKILIRFSDYVEVADAQDYDRRADK PWTRLTAADKAAIRKELNEFKSTEMEVHELSRHLTRFHRP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
21+dbSNP:
21+a, cdbSNP:376328014
34+a, gdbSNP:181144323
109+dbSNP:
109+c, tdbSNP:185585909
266+c, tdbSNP:78883632
270+a, gdbSNP:116494039
363+dbSNP:
363+c, gdbSNP:377686869
391+g, tdbSNP:200984506
437..438+, adbSNP:36000655
517+dbSNP:
517+a, gdbSNP:368875405
574+c, tdbSNP:199546311
595+g, tdbSNP:373807800
614+c, tdbSNP:200383533
645+dbSNP:
645+c, gdbSNP:200804785
654+c, gdbSNP:61746695
667+c, tdbSNP:373688362
670+c, tdbSNP:141282814
695+c, tdbSNP:371601733
726+a, gdbSNP:183412001
736+a, gdbSNP:374512850
781+a, gdbSNP:375814039
877+dbSNP:
877+a, gdbSNP:376467653
951+c, tdbSNP:370949552
958+c, tdbSNP:373815868
965+c, gdbSNP:376126977
969+c, gdbSNP:370905078
1006+a, gdbSNP:373983813
1014+c, tdbSNP:367868310
1015+a, gdbSNP:372411363
1065+dbSNP:
1065+g, tdbSNP:375270903
1084+a, gdbSNP:369125089
1090+a, gdbSNP:373195107
1114+c, gdbSNP:17602409
1123+c, tdbSNP:80070708
1123+c, tdbSNP:386469638
1124+a, gdbSNP:375123444
1151+c, tdbSNP:369952844
1208+c, tdbSNP:373416214
1250+a, gdbSNP:377093681
1273+c, tdbSNP:73725623
1293+c, tdbSNP:376549077
1348+a, gdbSNP:61745587
1414+dbSNP:
1414+a, gdbSNP:368693842
1442+a, gdbSNP:375774811
1482+c, tdbSNP:368118372
1507+c, tdbSNP:371583810
1521+c, tdbSNP:375258601
1528+c, tdbSNP:139729794
1579+c, tdbSNP:200995179
complement(1603)-t, cdbSNP:144652575
1660+dbSNP:
1660+c, tdbSNP:143766526
1708+a, gdbSNP:146889071
1724+c, tdbSNP:370759003
1841+dbSNP:
1841+c, gdbSNP:372053028
1849+a, gdbSNP:376361925
1900+dbSNP:
1900+a, gdbSNP:372733107
1903+a, gdbSNP:111555313
1963+c, tdbSNP:376680831
2011+c, tdbSNP:368787954
2034+dbSNP:
2034+a, gdbSNP:377313232
2061+c, gdbSNP:371212952
2121+dbSNP:
2121+c, g, tdbSNP:114265092
2162+g, tdbSNP:186017527
2164+a, cdbSNP:115925343
2174+c, tdbSNP:368435147
2205+c, tdbSNP:372445819
complement(2206)-t, cdbSNP:693758
2301+c, tdbSNP:190878673
2349..2350+, cdbSNP:35968832
2354..2355+, gdbSNP:200616252
complement(2455)-g, adbSNP:188024398
2455+, gdbSNP:34931301
2515..2516+, gdbSNP:36077798
2570+g, tdbSNP:373122194
2870+a, gdbSNP:183018319
Gene SymbolPHACTR1
Gene SynonymdJ257A7.2; RPEL; RPEL1
Chromosome6
Locus Map6p24.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_030948 Homo sapiens phosphatase and actin regulator 1 (PHACTR1), transcript variant 1, mRNA. On-demand $849.00 20
NM_001242648 Homo sapiens phosphatase and actin regulator 1 (PHACTR1), transcript variant 2, mRNA. On-demand $849.00 20
XM_006715021 PREDICTED: Homo sapiens phosphatase and actin regulator 1 (PHACTR1), transcript variant X6, mRNA. On-demand $849.00 20
XM_005248934 PREDICTED: Homo sapiens phosphatase and actin regulator 1 (PHACTR1), transcript variant X2, mRNA. On-demand $849.00 20
XM_005248933 PREDICTED: Homo sapiens phosphatase and actin regulator 1 (PHACTR1), transcript variant X1, mRNA. On-demand $849.00 20
XM_005248935 PREDICTED: Homo sapiens phosphatase and actin regulator 1 (PHACTR1), transcript variant X3, mRNA. On-demand $849.00 20
XM_005248936 PREDICTED: Homo sapiens phosphatase and actin regulator 1 (PHACTR1), transcript variant X4, mRNA. On-demand $699.00 18
XM_005248937 PREDICTED: Homo sapiens phosphatase and actin regulator 1 (PHACTR1), transcript variant X5, mRNA. On-demand $699.00 18
Title Genome-wide meta-analysis identifies new susceptibility loci for migraine .
Author Anttila V, Winsvold BS, Gormley P, Kurth T, Bettella F, McMahon G, Kallela M, Malik R, de Vries B, Terwindt G, Medland SE, Todt U, McArdle WL, Quaye L, Koiranen M, Ikram MA, Lehtimaki T, Stam AH, Ligthart L, Wedenoja J, Dunham I, Neale BM, Palta P, Hamalainen E, Schurks M, Rose LM, Buring JE, Ridker PM, Steinberg S, Stefansson H, Jakobsson F, Lawlor DA, Evans DM, Ring SM, Farkkila M, Artto V, Kaunisto MA, Freilinger T, Schoenen J, Frants RR, Pelzer N, Weller CM, Zielman R, Heath AC, Madden PA, Montgomery GW, Martin NG, Borck G, Gobel H, Heinze A, Heinze-Kuhn K, Williams FM, Hartikainen AL, Pouta A, van den Ende J, Uitterlinden AG, Hofman A, Amin N, Hottenga JJ, Vink JM, Heikkila K, Alexander M, Muller-Myhsok B, Schreiber S, Meitinger T, Wichmann HE, Aromaa A, Eriksson JG, Traynor BJ, Trabzuni D, Rossin E, Lage K, Jacobs SB, Gibbs JR, Birney E, Kaprio J, Penninx BW, Boomsma DI, van Duijn C, Raitakari O, Jarvelin MR, Zwart JA, Cherkas L, Strachan DP, Kubisch C, Ferrari MD, van den Maagdenberg AM, Dichgans M, Wessman M, Smith GD, Stefansson K, Daly MJ, Nyholt DR, Chasman DI and Palotie A.
Journal Nat. Genet. 45 (8), 912-917 (2013)
Title MicroRNA-584 and the protein phosphatase and actin regulator 1 (PHACTR1), a new signaling route through which transforming growth factor-beta Mediates the migration and actin dynamics of breast cancer cells .
Author Fils-Aime N, Dai M, Guo J, El-Mousawi M, Kahramangil B, Neel JC and Lebrun JJ.
Journal J. Biol. Chem. 288 (17), 11807-11823 (2013)
Title Genetic heritability of ischemic stroke and the contribution of previously reported candidate gene and genomewide associations .
Author Bevan S, Traylor M, Adib-Samii P, Malik R, Paul NL, Jackson C, Farrall M, Rothwell PM, Sudlow C, Dichgans M and Markus HS.
Journal Stroke 43 (12), 3161-3167 (2012)
Title Genome-wide linkage and association scans for pulse pressure in Chinese twins .
Author Zhang D, Pang Z, Li S, Jiang W, Wang S, Thomassen M, Hjelmborg JV, Kruse TA, Ohm Kyvik K, Christensen K, Zhu G and Tan Q.
Journal Hypertens. Res. 35 (11), 1051-1057 (2012)
Title Genome-wide association study in Han Chinese identifies four new susceptibility loci for coronary artery disease .
Author Lu X, Wang L, Chen S, He L, Yang X, Shi Y, Cheng J, Zhang L, Gu CC, Huang J, Wu T, Ma Y, Li J, Cao J, Chen J, Ge D, Fan Z, Li Y, Zhao L, Li H, Zhou X, Chen L, Liu D, Chen J, Duan X, Hao Y, Wang L, Lu F, Liu Z, Yao C, Shen C, Pu X, Yu L, Fang X, Xu L, Mu J, Wu X, Zheng R, Wu N, Zhao Q, Li Y, Liu X, Wang M, Yu D, Hu D, Ji X, Guo D, Sun D, Wang Q, Yang Y, Liu F, Mao Q, Liang X, Ji J, Chen P, Mo X, Li D, Chai G, Tang Y, Li X, Du Z, Liu X, Dou C, Yang Z, Meng Q, Wang D, Wang R, Yang J, Schunkert H, Samani NJ, Kathiresan S, Reilly MP, Erdmann J, Peng X, Wu X, Liu D, Yang Y, Chen R, Qiang B and Gu D.
Journal Nat. Genet. 44 (8), 890-894 (2012)
Title Neuropilin-1 regulates a new VEGF-induced gene, Phactr-1, which controls tubulogenesis and modulates lamellipodial dynamics in human endothelial cells .
Author Allain B, Jarray R, Borriello L, Leforban B, Dufour S, Liu WQ, Pamonsinlapatham P, Bianco S, Larghero J, Hadj-Slimane R, Garbay C, Raynaud F and Lepelletier Y.
Journal Cell. Signal. 24 (1), 214-223 (2012)
Title Genome-wide association study for coronary artery calcification with follow-up in myocardial infarction .
Author O'Donnell CJ, Kavousi M, Smith AV, Kardia SL, Feitosa MF, Hwang SJ, Sun YV, Province MA, Aspelund T, Dehghan A, Hoffmann U, Bielak LF, Zhang Q, Eiriksdottir G, van Duijn CM, Fox CS, de Andrade M, Kraja AT, Sigurdsson S, Elias-Smale SE, Murabito JM, Launer LJ, van der Lugt A, Kathiresan S, Krestin GP, Herrington DM, Howard TD, Liu Y, Post W, Mitchell BD, O'Connell JR, Shen H, Shuldiner AR, Altshuler D, Elosua R, Salomaa V, Schwartz SM, Siscovick DS, Voight BF, Bis JC, Glazer NL, Psaty BM, Boerwinkle E, Heiss G, Blankenberg S, Zeller T, Wild PS, Schnabel RB, Schillert A, Ziegler A, Munzel TF, White CC, Rotter JI, Nalls M, Oudkerk M, Johnson AD, Newman AB, Uitterlinden AG, Massaro JM, Cunningham J, Harris TB, Hofman A, Peyser PA, Borecki IB, Cupples LA, Gudnason V and Witteman JC.
Journal Circulation 124 (25), 2855-2864 (2011)
Title Depletion of the novel protein PHACTR-1 from human endothelial cells abolishes tube formation and induces cell death receptor apoptosis .
Author Jarray R, Allain B, Borriello L, Biard D, Loukaci A, Larghero J, Hadj-Slimane R, Garbay C, Lepelletier Y and Raynaud F.
Journal Biochimie 93 (10), 1668-1675 (2011)
Title A genome-wide association study in europeans and South asians identifies 5 new Loci for coronary artery disease .
Author Mehta NN.
Journal Circ Cardiovasc Genet 4 (4), 465-466 (2011)
Title Phactrs 1-4: A family of protein phosphatase 1 and actin regulatory proteins .
Author Allen PB, Greenfield AT, Svenningsson P, Haspeslagh DC and Greengard P.
Journal Proc. Natl. Acad. Sci. U.S.A. 101 (18), 7187-7192 (2004)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.