• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens BRCA1 interacting protein C-terminal helicase 1 (BRIP1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_032043 Homo sapiens BRCA1 interacting protein C-terminal helicase 1 (BRIP1), mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_032043.2, 301897117
Length 8166 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens BRCA1 interacting protein C-terminal helicase 1 (BRIP1), mRNA.
Product Fanconi anemia group J protein
Comment

Summary: The protein encoded by this gene is a member of the RecQ DEAH helicase family and interacts with the BRCT repeats of breast cancer, type 1 (BRCA1). The bound complex is important in the normal double-strand break repair function of breast cancer, type 1 (BRCA1). This gene may be a target of germline cancer-inducing mutations. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_114432.2
CDS 307..4056
Misc Feature(1)286..288
Misc Feature(2)778..831
Misc Feature(3)778..831
Misc Feature(4)1039..2949
Misc Feature(5)1048..1551
Misc Feature(6)1483..1494
Misc Feature(7)2344..2901
Misc Feature(8)2968..3495
Misc Feature(9)3085..3087
Misc Feature(10)3094..3096
Misc Feature(11)3274..3276
Misc Feature(12)3400..3402
Misc Feature(13)4015..4017
Misc Feature(14)4051..4053
Exon (1)1..276
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (2)277..399
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (3)400..511
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (4)512..685
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (5)686..813
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (6)814..933
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (7)934..1224
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (8)1225..1446
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (9)1447..1646
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (10)1647..1779
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (11)1780..1934
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (12)1935..2100
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (13)2101..2241
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (14)2242..2403
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (15)2404..2563
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (16)2564..2685
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (17)2686..2798
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (18)2799..2881
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (19)2882..3211
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Exon (20)3212..8166
Gene:BRIP1
Gene Synonym:BACH1; FANCJ; OF
Translation MSSMWSEYTIGGVKIYFPYKAYPSQLAMMNSILRGLNSKQHCLLESPTGSGKSLALLCSA LAWQQSLSGKPADEGVSEKAEVQLSCCCACHSKDFTNNDMNQGTSRHFNYPSTPPSERNG TSSTCQDSPEKTTLAAKLSAKKQASIYRDENDDFQVEKKRIRPLETTQQIRKRHCFGTEV HNLDAKVDSGKTVKLNSPLEKINSFSPQKPPGHCSRCCCSTKQGNSQESSNTIKKDHTGK SKIPKIYFGTRTHKQIAQITRELRRTAYSGVPMTILSSRDHTCVHPEVVGNFNRNEKCME LLDGKNGKSCYFYHGVHKISDQHTLQTFQGMCKAWDIEELVSLGKKLKACPYYTARELIQ DADIIFCPYNYLLDAQIRESMDLNLKEQVVILDEAHNIEDCARESASYSVTEVQLRFARD ELDSMVNNNIRKKDHEPLRAVCCSLINWLEANAEYLVERDYESACKIWSGNEMLLTLHKM GITTATFPILQGHFSAVLQKEEKISPIYGKEEAREVPVISASTQIMLKGLFMVLDYLFRQ NSRFADDYKIAIQQTYSWTNQIDISDKNGLLVLPKNKKRSRQKTAVHVLNFWCLNPAVAF SDINGKVQTIVLTSGTLSPMKSFSSELGVTFTIQLEANHIIKNSQVWVGTIGSGPKGRNL CATFQNTETFEFQDEVGALLLSVCQTVSQGILCFLPSYKLLEKLKERWLSTGLWHNLELV KTVIVEPQGGEKTNFDELLQVYYDAIKYKGEKDGALLVAVCRGKVSEGLDFSDDNARAVI TIGIPFPNVKDLQVELKRQYNDHHSKLRGLLPGRQWYEIQAYRALNQALGRCIRHRNDWG ALILVDDRFRNNPSRYISGLSKWVRQQIQHHSTFESALESLAEFSKKHQKVLNVSIKDRT NIQDNESTLEVTSLKYSTSPYLLEAASHLSPENFVEDEAKICVQELQCPKIITKNSPLPS SIISRKEKNDPVFLEEAGKAEKIVISRSTSPTFNKQTKRVSWSSFNSLGQYFTGKIPKAT PELGSSENSASSPPRFKTEKMESKTVLPFTDKCESSNLTVNTSFGSCPQSETIISSLKID ATLTRKNHSEHPLCSEEALDPDIELSLVSEEDKQSTSNRDFETEAEDESIYFTPELYDPE DTDEEKNDLAETDRGNRLANNSDCILAKDLFEIRTIKEVDSAREVKAEDCIDTKLNGILH IEESKIDDIDGNVKTTWINELELGKTHEIEIKNFKPSPSKNKGMFPGFK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(69..70)-dbSNP:
complement(69..70)-, adbSNP:112243287
complement(102)-t, cdbSNP:2048718
complement(110)-t, gdbSNP:180948389
complement(172)-g, cdbSNP:79220357
complement(177)-t, cdbSNP:4988339
complement(180)-g, adbSNP:148498140
complement(269)-g, adbSNP:371225829
complement(285)-dbSNP:
complement(285)-t, gdbSNP:377620948
316+a, gdbSNP:45512093
342+g, tdbSNP:45566938
375+a, gdbSNP:45458996
complement(409)-dbSNP:
complement(409)-t, cdbSNP:373104267
445+c, gdbSNP:28903098
complement(501)-t, cdbSNP:141436143
complement(511)-t, cdbSNP:372581879
complement(531)-dbSNP:
complement(531)-g, adbSNP:186802750
555+a, gdbSNP:45528833
complement(603)-g, adbSNP:201617644
complement(623)-t, cdbSNP:143615668
complement(638)-t, gdbSNP:201790351
complement(676)-g, adbSNP:45617634
complement(721)-dbSNP:
complement(721)-c, adbSNP:202072866
complement(736)-t, cdbSNP:116952709
complement(791)-t, c, adbSNP:61757643
complement(823)-dbSNP:
complement(823)-t, cdbSNP:4988345
complement(856)-c, adbSNP:201047375
883+a, gdbSNP:4988346
complement(883)-g, adbSNP:386597140
890+c, tdbSNP:4988347
complement(901)-g, adbSNP:144969738
complement(924)-t, cdbSNP:367614726
complement(934)-dbSNP:
complement(934)-g, adbSNP:150313156
complement(935)-t, g, adbSNP:140097800
complement(944)-t, cdbSNP:376760085
complement(950)-t, gdbSNP:12947398
complement(954)-t, cdbSNP:202035881
complement(968)-g, cdbSNP:373774920
985+c, gdbSNP:45459799
1008+a, gdbSNP:45512798
complement(1042)-t, cdbSNP:376893571
complement(1084)-t, cdbSNP:138743097
1096+c, tdbSNP:28997569
complement(1096)-g, adbSNP:386576837
complement(1101)-t, cdbSNP:61754143
complement(1126)-t, cdbSNP:62620988
1137+c, gdbSNP:45549332
1151+c, gdbSNP:45624635
complement(1158)-g, adbSNP:144940449
complement(1160)-t, cdbSNP:141055990
complement(1173)-g, adbSNP:147739458
complement(1174)-t, cdbSNP:145601931
complement(1175)-t, cdbSNP:148556781
1196+a, gdbSNP:28997570
complement(1196)-g, adbSNP:386576838
1203+a, gdbSNP:137852985
complement(1230)-dbSNP:
complement(1230)-t, cdbSNP:374974885
complement(1247)-t, cdbSNP:112076926
complement(1351)-g, cdbSNP:149364097
complement(1395)-g, adbSNP:139701369
complement(1513)-dbSNP:
complement(1513)-g, adbSNP:369631413
1544+c, tdbSNP:45576134
complement(1546)-g, adbSNP:368796923
1560..1561+c, tdbSNP:4988348
complement(1561)-g, adbSNP:150624408
complement(1563)-t, cdbSNP:148429663
complement(1638)-g, adbSNP:200581792
1739+dbSNP:
1739+a, gdbSNP:45501097
complement(1748)-c, adbSNP:200062099
complement(1750)-t, cdbSNP:142744352
complement(1791)-dbSNP:
complement(1791)-c, adbSNP:370658123
complement(1892)-t, cdbSNP:138784299
complement(1897)-t, gdbSNP:386597141
1897+g, tdbSNP:4988350
complement(1911)-g, cdbSNP:56024614
complement(1922)-t, cdbSNP:199616792
complement(1925)-t, adbSNP:4988349
complement(1932)-g, adbSNP:373709958
complement(1950)-dbSNP:
complement(1950)-g, adbSNP:372760869
complement(1958)-g, adbSNP:375246789
complement(1961)-g, adbSNP:369340666
1990+a, gdbSNP:45533636
complement(2001)-t, gdbSNP:142572387
complement(2012)-g, cdbSNP:373228183
complement(2016)-t, cdbSNP:370087045
complement(2027)-g, adbSNP:377302300
2041+c, tdbSNP:28997571
complement(2106)-dbSNP:
complement(2106)-c, adbSNP:375625993
complement(2115)-g, adbSNP:370393808
complement(2129)-t, cdbSNP:112505689
complement(2131)-t, cdbSNP:189758577
complement(2178)-t, cdbSNP:145504336
complement(2196)-t, cdbSNP:145796331
2205+c, gdbSNP:28997572
complement(2295)-dbSNP:
complement(2295)-t, gdbSNP:376628979
complement(2299..2300)-, gdbSNP:34224865
complement(2367)-g, cdbSNP:112414873
complement(2393)-g, adbSNP:147755155
complement(2426)-dbSNP:
complement(2426)-t, cdbSNP:200313471
complement(2473)-t, cdbSNP:145616741
2526+g, tdbSNP:45589637
complement(2538)-g, adbSNP:374362388
complement(2542)-t, cdbSNP:111536363
complement(2591)-dbSNP:
complement(2591)-t, cdbSNP:200960251
complement(2592)-g, adbSNP:61754141
complement(2594)-t, cdbSNP:371484780
complement(2602)-t, cdbSNP:371227751
complement(2607)-t, cdbSNP:369434185
complement(2616)-g, adbSNP:148752066
complement(2623)-t, cdbSNP:146091205
complement(2631)-c, adbSNP:375146450
complement(2650)-t, cdbSNP:142806416
complement(2676)-t, cdbSNP:372122365
2698+dbSNP:
2698+c, tdbSNP:137852986
complement(2699)-t, cdbSNP:375082407
complement(2746)-g, adbSNP:201869624
2747+a, gdbSNP:45468199
2774+g, tdbSNP:45479297
2801+dbSNP:
2801+a, gdbSNP:4988355
complement(2803)-t, cdbSNP:199831248
2848+c, tdbSNP:45572934
complement(2849)-t, cdbSNP:374334794
complement(2869)-g, adbSNP:146031731
complement(2870)-t, c, adbSNP:200894063
complement(2874)-g, adbSNP:370175724
complement(2875)-g, adbSNP:28904918
complement(2875)-g, adbSNP:386576414
complement(2896)-dbSNP:
complement(2896)-t, cdbSNP:149529390
complement(2905)-t, gdbSNP:182028200
complement(2919)-g, adbSNP:199721657
2943+a, gdbSNP:4986765
complement(2943)-g, adbSNP:386596996
complement(3057)-g, adbSNP:150780318
3061+c, tdbSNP:4986764
3110+g, tdbSNP:4988356
complement(3110)-c, adbSNP:386597143
complement(3117)-g, adbSNP:374335608
complement(3118)-t, cdbSNP:199643061
complement(3131)-t, cdbSNP:370330739
complement(3136)-g, cdbSNP:140233356
complement(3137)-t, cdbSNP:148232408
3153+c, tdbSNP:45499991
complement(3160)-t, cdbSNP:200239986
complement(3164)-g, adbSNP:201672040
complement(3172)-g, adbSNP:74824981
complement(3179)-t, adbSNP:145859791
complement(3189)-g, adbSNP:367728797
complement(3199)-t, cdbSNP:113697814
complement(3243)-dbSNP:
complement(3243)-t, cdbSNP:75091137
complement(3263)-g, cdbSNP:182087528
3297+a, gdbSNP:45466996
complement(3348)-g, adbSNP:188258913
complement(3375)-g, adbSNP:61754142
complement(3376)-t, cdbSNP:147119272
complement(3385)-t, cdbSNP:371185409
complement(3405)-g, adbSNP:202228407
3409+c, tdbSNP:45437094
complement(3410)-t, cdbSNP:367816363
complement(3455)-t, gdbSNP:373040333
complement(3484)-t, cdbSNP:149016505
3501+a, gdbSNP:45540240
complement(3529)-t, adbSNP:368867532
complement(3530)-g, adbSNP:183928474
complement(3542)-g, adbSNP:150813402
complement(3582)-t, cdbSNP:375911315
complement(3622)-g, adbSNP:111943191
complement(3642)-g, adbSNP:369843642
complement(3684)-t, gdbSNP:145855459
3688+a, gdbSNP:45552539
complement(3709)-t, cdbSNP:369340444
3717+c, tdbSNP:4986763
3750+a, cdbSNP:28997573
3765+c, tdbSNP:4987050
complement(3765)-g, adbSNP:386597017
3770+a, gdbSNP:45603843
complement(3781)-c, adbSNP:368610199
complement(3795)-g, adbSNP:144245485
complement(3813)-t, gdbSNP:375741316
complement(3829)-t, cdbSNP:372799558
complement(3837)-t, cdbSNP:181186298
complement(3865)-t, cdbSNP:367610893
complement(3926)-t, adbSNP:139539831
complement(3935)-t, cdbSNP:112214651
complement(3942)-g, adbSNP:374392860
complement(3987)-g, adbSNP:370581038
complement(4095)-t, cdbSNP:202123733
4133+a, cdbSNP:4988358
complement(4184)-t, cdbSNP:150444311
complement(4188)-t, cdbSNP:143361598
complement(4209)-g, cdbSNP:113345004
complement(4211)-, adbSNP:376507309
4214+c, tdbSNP:1978111
complement(4221..4222)-, adbSNP:111519368
complement(4228)-g, cdbSNP:111898257
complement(4336)-g, cdbSNP:189935192
complement(4539)-g, adbSNP:7213430
complement(4556)-c, adbSNP:377169249
complement(4580)-t, cdbSNP:371689236
complement(4659)-g, adbSNP:368711371
complement(4672)-t, cdbSNP:116292412
complement(4785)-g, adbSNP:137967725
complement(4830)-t, cdbSNP:376898714
complement(4835)-g, adbSNP:185040281
complement(4931)-t, gdbSNP:193165407
complement(5034)-t, cdbSNP:367962443
complement(5258)-t, adbSNP:113940104
complement(5273)-g, adbSNP:374389912
complement(5289)-t, adbSNP:372430235
complement(5307)-g, adbSNP:374318992
complement(5319)-t, cdbSNP:73991940
complement(5373)-c, adbSNP:368664791
complement(5430)-g, adbSNP:59115933
complement(5659)-t, cdbSNP:374453575
complement(5702)-g, cdbSNP:145338121
complement(5849)-t, adbSNP:190169023
complement(5876)-g, adbSNP:114037902
complement(5924)-c, adbSNP:184666432
complement(5990)-g, adbSNP:192638855
6020+a, gdbSNP:140267868
6138..6146+cccac, tgtccccagdbSNP:71354633
complement(6138..6141)-, gacadbSNP:10601136
complement(6139..6142)-, ggacdbSNP:201539878
complement(6146)-g, cdbSNP:60657820
complement(6182)-g, adbSNP:72841539
complement(6262)-t, cdbSNP:370187046
complement(6297)-g, adbSNP:76889595
complement(6393)-t, adbSNP:373664066
complement(6473)-c, adbSNP:370627515
complement(6517)-g, adbSNP:369814581
complement(6525)-g, adbSNP:375782378
complement(6594)-t, cdbSNP:150080122
complement(6646)-g, cdbSNP:372463784
complement(6648)-t, cdbSNP:186580238
complement(6660)-t, gdbSNP:369363061
complement(6723)-g, adbSNP:373156872
complement(6772)-t, cdbSNP:376023094
complement(6812)-t, cdbSNP:182264505
complement(6834)-t, cdbSNP:377740071
complement(6854)-t, gdbSNP:76424050
complement(6868..6869)-, cdbSNP:10637696
complement(6868)-t, cdbSNP:112375062
complement(6872)-t, cdbSNP:375971837
complement(6942)-t, gdbSNP:374366450
complement(7017)-g, cdbSNP:373172543
complement(7169..7170)-, adbSNP:371930656
complement(7170)-, adbSNP:35235448
complement(7244)-t, cdbSNP:369850537
complement(7358)-c, adbSNP:188292745
complement(7467..7470)-, gtcadbSNP:145439881
complement(7506)-g, adbSNP:74859843
complement(7544)-t, adbSNP:11079454
complement(7545)-g, adbSNP:140891191
complement(7570)-c, adbSNP:10744996
complement(7636)-t, adbSNP:372023591
complement(7647)-t, adbSNP:73326602
complement(7811)-t, cdbSNP:183234058
complement(7824)-g, adbSNP:368234785
complement(8056)-g, adbSNP:8077553
complement(8096)-t, adbSNP:111580456
complement(8109)-g, adbSNP:191840743
Gene SymbolBRIP1
Gene SynonymBACH1; FANCJ; OF
Chromosome17
Locus Map17q22.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_032043 Homo sapiens BRCA1 interacting protein C-terminal helicase 1 (BRIP1), mRNA. On-demand $1699.00 25
Title Gene network analysis in a pediatric cohort identifies novel lung function genes .
Author Ong BA, Li J, McDonough JM, Wei Z, Kim C, Chiavacci R, Mentch F, Caboot JB, Spergel J, Allen JL, Sleiman PM and Hakonarson H.
Journal PLoS ONE 8 (9), E72899 (2013)
Title First evidence for the contribution of the genetic variations of BRCA1-interacting protein 1 (BRIP1) to the genetic susceptibility of cervical cancer .
Author Ma XD, Cai GQ, Zou W, Huang YH, Zhang JR, Wang DT and Chen BL.
Journal Gene 524 (2), 208-213 (2013)
Title Fanconi anemia group J helicase and MRE11 nuclease interact to facilitate the DNA damage response .
Author Suhasini AN, Sommers JA, Muniandy PA, Coulombe Y, Cantor SB, Masson JY, Seidman MM and Brosh RM Jr.
Journal Mol. Cell. Biol. 33 (11), 2212-2227 (2013)
Title BRIP1 variations analysis reveals their relative importance as genetic susceptibility factor for cervical cancer .
Author Ma XD, Cai GQ, Zou W, Huang YH, Zhang JR, Wang DT and Chen BL.
Journal Biochem. Biophys. Res. Commun. 433 (2), 232-236 (2013)
Title Association between BRIP1 (BACH1) polymorphisms and breast cancer risk: a meta-analysis .
Author Pabalan N, Jarjanazi H and Ozcelik H.
Journal Breast Cancer Res. Treat. 137 (2), 553-558 (2013)
Title No evidence of involvement of germline BACH1 mutations in Finnish breast and ovarian cancer families .
Author Karppinen SM, Vuosku J, Heikkinen K, Allinen M and Winqvist R.
Journal Eur. J. Cancer 39 (3), 366-371 (2003)
Title No mutations in the BACH1 gene in BRCA1 and BRCA2 negative breast-cancer families linked to 17q22 .
Author Luo,L., Lei,H., Du,Q., von Wachenfeldt,A., Kockum,I., Luthman,H., Vorechovsky,I. and Lindblom,A.
Journal Int. J. Cancer 98 (4), 638-639 (2002)
Title SUVi and BACH1: a new subfamily of mammalian helicases? .
Author Menichini P and Linial M.
Journal Mutat. Res. 487 (1-2), 67-71 (2001)
Title BACH1, a novel helicase-like protein, interacts directly with BRCA1 and contributes to its DNA repair function .
Author Cantor SB, Bell DW, Ganesan S, Kass EM, Drapkin R, Grossman S, Wahrer DC, Sgroi DC, Lane WS, Haber DA and Livingston DM.
Journal Cell 105 (1), 149-160 (2001)
Title Fanconi Anemia .
Author Alter,B.P. and Kupfer,G.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.