• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu17844 Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA. pcDNA3.1+-DYK On-demand TBD -1
OHu17844C Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA. Customized vector On-demand TBD -1

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_032387.4, 260166636
Length 3732 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA.
Product serine/threonine-protein kinase WNK4
Comment

Summary: This gene encodes a member of the WNK family of serine-threonine protein kinases. The kinase is part of the tight junction complex in kidney cells, and regulates the balance between NaCl reabsorption and K(+) secretion. The kinase regulates the activities of several types of ion channels, cotransporters, and exchangers involved in electrolyte flux in epithelial cells. Mutations in this gene result in pseudohypoaldosteronism type IIB.[provided by RefSeq, Sep 2009].

RefSeq NP_115763.2
CDS 69..3800
Misc Feature(1)603..1364
Misc Feature(2)603..1364
Misc Feature(3)606..1364
Misc Feature(4)order(606..620,630..632,669..671,675..677,768..770,
Misc Feature(5)order(606..620,630..632,669..671,675..677,768..770,
Misc Feature(6)order(618..620,849..851,855..857,972..974,978..980,
Misc Feature(7)order(1026..1046,1080..1091)
Misc Feature(8)1425..1535
Misc Feature(9)<3015..>3392
Exon (1)1..686
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (2)687..859
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (3)860..1080
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (4)1081..1238
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (5)1239..1327
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (6)1328..1544
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (7)1545..1809
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (8)1810..1931
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (9)1932..1990
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (10)1991..2108
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (11)2109..2225
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (12)2226..2363
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (13)2364..2418
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (14)2419..3029
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (15)3030..3090
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (16)3091..3499
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (17)3500..3699
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (18)3700..3797
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (19)3798..4178
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Translation MLASPATETTVLMSQTEADLALRPPPPLGTAGQPRLGPPPRRARRFSGKAEPRPRSSRLS RRSSVDLGLLSSWSLPASPAPDPPDPPDSAGPGPARSPPPSSKEPPEGTWTEGAPVKAAE DSARPELPDSAVGPGSREPLRVPEAVALERRREQEEKEDMETQAVATSPDGRYLKFDIEI GRGSFKTVYRGLDTDTTVEVAWCELQTRKLSRAERQRFSEEVEMLKGLQHPNIVRFYDSW KSVLRGQVCIVLVTELMTSGTLKTYLRRFREMKPRVLQRWSRQILRGLHFLHSRVPPILH RDLKCDNVFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDEAVDVYA FGMCMLEMATSEYPYSECQNAAQIYRKVTSGRKPNSFHKVKIPEVKEIIEGCIRTDKNER FTIQDLLAHAFFREERGVHVELAEEDDGEKPGLKLWLRMEDARRGGRPRDNQAIEFLFQL GRDAAEEVAQEMVALGLVCEADYQPVARAVRERVAAIQRKREKLRKARELEALPPEPGPP PATVPMAPGPPSVFPPEPEEPEADQHQPFLFRHASYSSTTSDCETDGYLSSSGFLDASDP ALQPPGGVPSSLAESHLCLPSAFALSIPRSGPGSDFSPGDSYASDAASGLSDVGEGMGQM RRPPGRNLRRRPRSRLRVTSVSDQNDRVVECQLQTHNSKMVTFRFDLDGDSPEEIAAAMV YNEFILPSERDGFLRRIREIIQRVETLLKRDTGPMEAAEDTLSPQEEPAPLPALPVPLPD PSNEELQSSTSLEHRSWTAFSTSSSSPGTPLSPGNPFSPGTPISPGPIFPITSPPCHPSP SPFSPISSQVSSNPSPHPTSSPLPFSSSTPEFPVPLSQCPWSSLPTTSPPTFSPTCSQVT LSSPFFPPCPSTSSFPSTTAAPLLSLASAFSLAVMTVAQSLLSPSPGLLSQSPPAPPSPL PSLPLPPPVAPGGQESPSPHTAEVESEASPPPARPLPGEARLAPISEEGKPQLVGRFQVT SSKEPAEPLPLQPTSPTLSGSPKPSTPQLTSESSDTEDSAGGGPETREALAESDRAAEGL GAGVEEEGDDGKEPQVGGSPQPLSHPSPVWMNYSYSSLCLSSEESESSGEDEEFWAELQS LRQKHLSEVETLQTLQKKEIEDLYSRLGKQPPPGIVAPAAMLSSRQRRLSKGSFPTSRRN SLQRSEPPGPGIMRRNSLSGSSTGSQEQRASKGVTFAGDVGRM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
22+dbSNP:
22+c, tdbSNP:375681809
26+a, cdbSNP:370313183
41+c, tdbSNP:374744005
47+c, tdbSNP:200318202
51+a, g, tdbSNP:61754323
62+a, cdbSNP:202057094
84+a, gdbSNP:61754324
115+c, tdbSNP:61754325
135+c, tdbSNP:368683340
138+c, tdbSNP:371972656
160+a, cdbSNP:370527167
193+a, gdbSNP:374001790
231+c, tdbSNP:201419013
250+a, gdbSNP:375444500
272+a, gdbSNP:200209645
277+g, tdbSNP:369689386
307+a, cdbSNP:61754326
311+g, tdbSNP:371379940
312+g, tdbSNP:368949418
314+a, cdbSNP:373427674
330+c, gdbSNP:375244096
336+g, tdbSNP:199712166
365+g, tdbSNP:61754327
442+c, gdbSNP:369221665
509+c, gdbSNP:112188737
518+a, gdbSNP:377745941
complement(526)-g, adbSNP:78058990
542+a, gdbSNP:146717828
544+a, gdbSNP:373246842
561+g, tdbSNP:140344387
568+a, cdbSNP:376782226
569+a, gdbSNP:201054911
575+a, cdbSNP:61754328
614+a, tdbSNP:387907563
690+dbSNP:
690+c, tdbSNP:201212813
691+a, gdbSNP:375355128
718+a, gdbSNP:374594203
719+c, tdbSNP:146515383
747+g, tdbSNP:140897013
749+c, gdbSNP:75749468
750+c, gdbSNP:75596106
784+c, gdbSNP:199775692
798+c, tdbSNP:78232600
844+c, tdbSNP:138156012
845+a, gdbSNP:149157215
851+a, gdbSNP:371430478
904+dbSNP:
904+a, gdbSNP:112475091
946+c, gdbSNP:146556309
950+a, gdbSNP:201337475
1001+a, gdbSNP:200256086
1005+c, gdbSNP:139202412
1009+c, tdbSNP:368501387
1013+c, tdbSNP:61754348
1041+a, gdbSNP:387907559
1053+c, tdbSNP:142280606
1080+c, gdbSNP:373585658
1119+dbSNP:
1119+a, gdbSNP:375379956
1123+a, cdbSNP:76310211
1129+a, gdbSNP:368410238
1170+a, gdbSNP:147522675
1218+a, gdbSNP:369228385
1238+g, tdbSNP:148161064
1265+dbSNP:
1265+a, gdbSNP:183280336
1290+a, tdbSNP:369420670
1292+c, gdbSNP:373485019
1308+a, cdbSNP:377462363
1309+c, gdbSNP:370300499
1322+c, tdbSNP:373040449
1361+dbSNP:
1361+c, tdbSNP:142027397
1391+a, tdbSNP:387907562
1397+a, gdbSNP:55772936
1413+a, gdbSNP:373109872
1420+c, tdbSNP:61754356
1441+a, gdbSNP:368869602
1455+c, tdbSNP:372972035
1462+a, gdbSNP:145499777
1469+c, tdbSNP:375945297
1473+c, tdbSNP:370770635
1512+c, tdbSNP:387907556
1553+dbSNP:
1553+a, gdbSNP:184632930
1578+c, tdbSNP:200593980
1590+c, tdbSNP:201947637
1591+a, gdbSNP:55997156
1592+c, tdbSNP:55879206
1594+c, tdbSNP:143222801
1599+c, tdbSNP:146216767
1622+a, gdbSNP:61755589
1624+a, gdbSNP:139245311
1640+g, tdbSNP:144084546
1641+c, tdbSNP:145020225
1642+a, gdbSNP:200182836
1651+a, gdbSNP:373742806
1666+c, tdbSNP:112963672
1709+c, tdbSNP:9916754
1710+c, gdbSNP:371668464
1712+c, tdbSNP:142230858
1721+c, tdbSNP:55751736
1728+a, tdbSNP:201848994
1732+c, gdbSNP:57737815
1734+a, c, gdbSNP:56003090
1740+c, tdbSNP:374889836
1747+a, gdbSNP:193922734
1750+c, tdbSNP:193922735
1752+a, gdbSNP:137853093
1758+c, gdbSNP:193922736
1759+a, cdbSNP:137853094
1761+c, gdbSNP:137853092
1787+c, tdbSNP:56243382
1868+dbSNP:
1868+, tdbSNP:61755595
1869+g, tdbSNP:55781437
1871+c, tdbSNP:374742463
1886+a, gdbSNP:149633706
1895+a, gdbSNP:201340788
1897+c, tdbSNP:377697081
1921+g, tdbSNP:143396070
1933+dbSNP:
1933+c, gdbSNP:201356607
1953+c, tdbSNP:61755600
1956+c, tdbSNP:56030257
1960+a, gdbSNP:387907557
1969+g, tdbSNP:368190514
1977..1978+, cdbSNP:35772851
1978+c, tdbSNP:377536508
1982+c, tdbSNP:368434117
1983+a, gdbSNP:61755602
1986+a, gdbSNP:199767685
2022+dbSNP:
2022+a, gdbSNP:376641891
2034+a, gdbSNP:374463256
2074+a, gdbSNP:146190504
2077+a, gdbSNP:367768336
2091+c, tdbSNP:61755604
2092+a, gdbSNP:202162490
2097+c, tdbSNP:9896991
2099+a, gdbSNP:201748544
2148+dbSNP:
2148+c, tdbSNP:142471423
2152+c, gdbSNP:387907561
2179+a, gdbSNP:150554297
2204+a, gdbSNP:372128794
2230+dbSNP:
2230+a, gdbSNP:140819480
2253+c, gdbSNP:370712588
2257+a, gdbSNP:373527062
2274+c, tdbSNP:376404874
2275+a, gdbSNP:149389156
2281+a, gdbSNP:200823152
2287+c, tdbSNP:201510716
2292+c, gdbSNP:189584917
2296+a, gdbSNP:139570279
2346+a, gdbSNP:200807433
2394+dbSNP:
2394+a, gdbSNP:200438705
2402+a, gdbSNP:386465501
2402+c, tdbSNP:61755621
2408+a, cdbSNP:199864937
2416+a, gdbSNP:145613797
2432+dbSNP:
2432+c, tdbSNP:56376863
2437+a, cdbSNP:56227191
2450+c, gdbSNP:56231972
2452+c, gdbSNP:185780530
2460+a, tdbSNP:61755624
complement(2473)-c, adbSNP:35725557
2491+c, gdbSNP:147081637
2498+g, tdbSNP:369887011
2542+c, tdbSNP:56226218
2544+a, gdbSNP:190384194
2549+c, tdbSNP:200744992
2570+a, cdbSNP:372719835
2637+c, tdbSNP:61755626
2645+c, tdbSNP:387907558
2720+a, cdbSNP:376535315
2739+a, gdbSNP:141615112
2740+c, tdbSNP:56081375
2741+a, gdbSNP:151077943
2786+c, tdbSNP:387907564
complement(2792)-t, cdbSNP:2290042
2806+c, tdbSNP:368043109
2820+a, gdbSNP:200057224
2833+c, tdbSNP:201592842
2858+c, tdbSNP:201032525
2891+a, gdbSNP:371107660
2905+c, gdbSNP:200187290
2907+a, gdbSNP:368185978
2910+a, cdbSNP:372807256
complement(2949)-g, adbSNP:2290041
2961+c, tdbSNP:200640984
2972+c, tdbSNP:138944002
2973+a, gdbSNP:202060087
2976+c, gdbSNP:372187677
3077+dbSNP:
3077+a, gdbSNP:142279974
3100+dbSNP:
3100+c, gdbSNP:61755628
3105+c, gdbSNP:376863636
3114+c, tdbSNP:370684411
3123+g, tdbSNP:201925752
3142+c, tdbSNP:56099549
3143+a, gdbSNP:375116020
3147+a, gdbSNP:377665825
3174+c, tdbSNP:370906094
3250+c, gdbSNP:142406282
3291+c, tdbSNP:201421543
3292+a, gdbSNP:200263366
3295+c, tdbSNP:143956890
3319+c, tdbSNP:148648427
3349+c, gdbSNP:371930924
3434+c, tdbSNP:373691033
3435+a, gdbSNP:367565094
3451+a, gdbSNP:371666484
3462+a, gdbSNP:374887223
3464+a, gdbSNP:150858674
3492+c, tdbSNP:371972756
3493+a, gdbSNP:369907969
3548+dbSNP:
3548+g, tdbSNP:201060010
3558+c, tdbSNP:141257205
3573+a, gdbSNP:193922737
3586+a, cdbSNP:117902541
3587+a, gdbSNP:367834726
3604+c, tdbSNP:387907560
3621+c, tdbSNP:137853095
3622+a, gdbSNP:61755631
3661+a, gdbSNP:61755632
3663+a, cdbSNP:200519604
3678+c, tdbSNP:56116165
3729+dbSNP:
3729+a, gdbSNP:201075094
3748+a, cdbSNP:368730175
3776+c, tdbSNP:377529825
3780+a, gdbSNP:371087263
3806+dbSNP:
3806+a, gdbSNP:61755635
3814+a, gdbSNP:202219527
3910+a, cdbSNP:200888932
3975+a, gdbSNP:191035468
4057+a, gdbSNP:111588847
4068+a, gdbSNP:377763866
4135+c, gdbSNP:61755636
Gene SymbolWNK4
Gene SynonymPHA2B; PRKWNK4
Chromosome17
Locus Map17q21-q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_032387 Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA. On-demand TBD TBD
NM_032387 Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA. On-demand TBD TBD
NM_032387 Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA. On-demand TBD TBD
NM_032387 Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA. On-demand TBD TBD
NM_032387 Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA. On-demand TBD TBD
NM_032387 Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA. On-demand TBD TBD
NM_032387 Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA. On-demand TBD TBD
NM_032387 Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA. On-demand TBD TBD
Title Regulation of large-conductance Ca2+-activated K+ channels by WNK4 kinase .
Author Wang Z, Subramanya AR, Satlin LM, Pastor-Soler NM, Carattino MD and Kleyman TR.
Journal Am. J. Physiol., Cell Physiol. 305 (8), C846-C853 (2013)
Title Decrease of WNK4 ubiquitination by disease-causing mutations of KLHL3 through different molecular mechanisms .
Author Mori Y, Wakabayashi M, Mori T, Araki Y, Sohara E, Rai T, Sasaki S and Uchida S.
Journal Biochem. Biophys. Res. Commun. 439 (1), 30-34 (2013)
Title WNK4 inhibition of ENaC is independent of Nedd4-2-mediated ENaC ubiquitination .
Author Yu L, Cai H, Yue Q, Alli AA, Wang D, Al-Khalili O, Bao HF and Eaton DC.
Journal Am. J. Physiol. Renal Physiol. 305 (1), F31-F41 (2013)
Title Disease-causing mutations in KLHL3 impair its effect on WNK4 degradation .
Author Wu G and Peng JB.
Journal FEBS Lett. 587 (12), 1717-1722 (2013)
Title WNK4 regulates apical and basolateral Cl- flux in extrarenal epithelia .
Author Kahle KT, Gimenez I, Hassan H, Wilson FH, Wong RD, Forbush B, Aronson PS and Lifton RP.
Journal Proc. Natl. Acad. Sci. U.S.A. 101 (7), 2064-2069 (2004)
Title Molecular pathogenesis of inherited hypertension with hyperkalemia: the Na-Cl cotransporter is inhibited by wild-type but not mutant WNK4 .
Author Wilson FH, Kahle KT, Sabath E, Lalioti MD, Rapson AK, Hoover RS, Hebert SC, Gamba G and Lifton RP.
Journal Proc. Natl. Acad. Sci. U.S.A. 100 (2), 680-684 (2003)
Title Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants .
Author Wistow G, Bernstein SL, Wyatt MK, Fariss RN, Behal A, Touchman JW, Bouffard G, Smith D and Peterson K.
Journal Mol. Vis. 8, 205-220 (2002)
Title WNK kinases, a novel protein kinase subfamily in multi-cellular organisms .
Author Verissimo F and Jordan P.
Journal Oncogene 20 (39), 5562-5569 (2001)
Title Human hypertension caused by mutations in WNK kinases .
Author Wilson FH, Disse-Nicodeme S, Choate KA, Ishikawa K, Nelson-Williams C, Desitter I, Gunel M, Milford DV, Lipkin GW, Achard JM, Feely MP, Dussol B, Berland Y, Unwin RJ, Mayan H, Simon DB, Farfel Z, Jeunemaitre X and Lifton RP.
Journal Science 293 (5532), 1107-1112 (2001)
Title Pseudohypoaldosteronism Type II .
Author Wilson,F.H. and Kahle,K.T.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.