Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA.
| RefSeq Version | NM_032387.4, 260166636 |
| Length | 4194 bp |
| Structure | linear |
| Update Date | 01-MAY-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA. |
| Product | serine/threonine-protein kinase WNK4 |
| Comment | Summary: This gene encodes a member of the WNK family of serine-threonine protein kinases. The kinase is part of the tight junction complex in kidney cells, and regulates the balance between NaCl reabsorption and K(+) secretion. The kinase regulates the activities of several types of ion channels, cotransporters, and exchangers involved in electrolyte flux in epithelial cells. Mutations in this gene result in pseudohypoaldosteronism type IIB. |
| RefSeq | NP_115763.2 |
| CDS | 69..3800 | Exon (1) | 1..686 | Exon (2) | 1..686 | Exon (3) | 687..859 | Exon (4) | 860..1080 | Exon (5) | 1081..1238 | Exon (6) | 1239..1327 | Exon (7) | 1328..1544 | Exon (8) | 1545..1809 | Exon (9) | 1810..1931 | Exon (10) | 1932..1990 | Exon (11) | 1991..2108 | Exon (12) | 2109..2225 | Exon (13) | 2226..2363 | Exon (14) | 2364..2418 | Exon (15) | 2419..3029 | Exon (16) | 3030..3090 | Exon (17) | 3091..3499 | Exon (18) | 3500..3699 | Exon (19) | 3700..3797 | Exon (20) | 3798..4178 |
| Translation | MLASPATETTVLMSQTEADLALRPPPPLGTAGQPRLGPPPRRARRFSGKAEPRPRSSRLS
RRSSVDLGLLSSWSLPASPAPDPPDPPDSAGPGPARSPPPSSKEPPEGTWTEGAPVKAAE
DSARPELPDSAVGPGSREPLRVPEAVALERRREQEEKEDMETQAVATSPDGRYLKFDIEI
GRGSFKTVYRGLDTDTTVEVAWCELQTRKLSRAERQRFSEEVEMLKGLQHPNIVRFYDSW
KSVLRGQVCIVLVTELMTSGTLKTYLRRFREMKPRVLQRWSRQILRGLHFLHSRVPPILH
RDLKCDNVFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDEAVDVYA
FGMCMLEMATSEYPYSECQNAAQIYRKVTSGRKPNSFHKVKIPEVKEIIEGCIRTDKNER
FTIQDLLAHAFFREERGVHVELAEEDDGEKPGLKLWLRMEDARRGGRPRDNQAIEFLFQL
GRDAAEEVAQEMVALGLVCEADYQPVARAVRERVAAIQRKREKLRKARELEALPPEPGPP
PATVPMAPGPPSVFPPEPEEPEADQHQPFLFRHASYSSTTSDCETDGYLSSSGFLDASDP
ALQPPGGVPSSLAESHLCLPSAFALSIPRSGPGSDFSPGDSYASDAASGLSDVGEGMGQM
RRPPGRNLRRRPRSRLRVTSVSDQNDRVVECQLQTHNSKMVTFRFDLDGDSPEEIAAAMV
YNEFILPSERDGFLRRIREIIQRVETLLKRDTGPMEAAEDTLSPQEEPAPLPALPVPLPD
PSNEELQSSTSLEHRSWTAFSTSSSSPGTPLSPGNPFSPGTPISPGPIFPITSPPCHPSP
SPFSPISSQVSSNPSPHPTSSPLPFSSSTPEFPVPLSQCPWSSLPTTSPPTFSPTCSQVT
LSSPFFPPCPSTSSFPSTTAAPLLSLASAFSLAVMTVAQSLLSPSPGLLSQSPPAPPSPL
PSLPLPPPVAPGGQESPSPHTAEVESEASPPPARPLPGEARLAPISEEGKPQLVGRFQVT
SSKEPAEPLPLQPTSPTLSGSPKPSTPQLTSESSDTEDSAGGGPETREALAESDRAAEGL
GAGVEEEGDDGKEPQVGGSPQPLSHPSPVWMNYSYSSLCLSSEESESSGEDEEFWAELQS
LRQKHLSEVETLQTLQKKEIEDLYSRLGKQPPPGIVAPAAMLSSRQRRLSKGSFPTSRRN
SLQRSEPPGPGIMRRNSLSGSSTGSQEQRASKGVTFAGDVGRM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Gene Symbol | WNK4 |
| Gene Synonym | PHA2B; PRKWNK4 |
| Chromosome | 17 |
| Locus Map | 17q21-q22 |
| All Transcripts | NM_032387 |
| Title | WNK4 kinase negatively regulates the surface expression of muscarinic M3 receptor . |
| Author | Chung,W.Y., Park,H.W., Heo,D.K., Kim,K.H., Lee,M.G. and Kim,J.Y. |
| Journal | Cell. Signal. 23 (3), 566-571 (2011) |
| Title | Estrogen regulation of human with-no-lysine (K) kinase-4 gene expression involves AP-1 transcription factor . |
| Author | Zhang,Y., Li,C., Li,W. and Zhao,Y. |
| Journal | Mol. Cell. Endocrinol. 332 (1-2), 140-148 (2011) |
| Title | Concerted actions of NHERF2 and WNK4 in regulating TRPV5 . |
| Author | Jing,H., Na,T., Zhang,W., Wu,G., Liu,C. and Peng,J.B. |
| Journal | Biochem. Biophys. Res. Commun. 404 (4), 979-984 (2011) |
| Title | [Association of the C1155547T polymorphism in WNK4 gene with essential hypertension in Xinjiang Kazakhs] . |
| Author | Cao,F.F., Zhang,H.X., Wang,F., Chen,X.D., Wang,X.F., Lin,R.Y., Wen,H., Lu,M. and Jin,L. |
| Journal | Zhonghua Yi Xue Yi Chuan Xue Za Zhi 27 (5), 546-549 (2010) |
| Title | WNK4 regulates apical and basolateral Cl- flux in extrarenal epithelia . |
| Author | Kahle,K.T., Gimenez,I., Hassan,H., Wilson,F.H., Wong,R.D., Forbush,B., Aronson,P.S. and Lifton,R.P. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 101 (7), 2064-2069 (2004) |
| Title | Genetic variants of WNK4 in whites and African Americans with hypertension . |
| Author | Erlich,P.M., Cui,J., Chazaro,I., Farrer,L.A., Baldwin,C.T., Gavras,H. and DeStefano,A.L. |
| Journal | Hypertension 41 (6), 1191-1195 (2003) |
| Title | Molecular pathogenesis of inherited hypertension with hyperkalemia: the Na-Cl cotransporter is inhibited by wild-type but not mutant WNK4 . |
| Author | Wilson,F.H., Kahle,K.T., Sabath,E., Lalioti,M.D., Rapson,A.K., Hoover,R.S., Hebert,S.C., Gamba,G. and Lifton,R.P. |
| Journal | Proc. Natl. Acad. Sci. U.S.A. 100 (2), 680-684 (2003) |
| Title | Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants . |
| Author | Wistow,G., Bernstein,S.L., Wyatt,M.K., Fariss,R.N., Behal,A., Touchman,J.W., Bouffard,G., Smith,D. and Peterson,K. |
| Journal | Mol. Vis. 8, 205-220 (2002) |
| Title | WNK kinases, a novel protein kinase subfamily in multi-cellular organisms . |
| Author | Verissimo,F. and Jordan,P. |
| Journal | Oncogene 20 (39), 5562-5569 (2001) |
| Title | Human hypertension caused by mutations in WNK kinases . |
| Author | Wilson,F.H., Disse-Nicodeme,S., Choate,K.A., Ishikawa,K., Nelson-Williams,C., Desitter,I., Gunel,M., Milford,D.V., Lipkin,G.W., Achard,J.M., Feely,M.P., Dussol,B., Berland,Y., Unwin,R.J., Mayan,H., Simon,D.B., Farfel,Z., Jeunemaitre,X. and Lifton,R.P. |
| Journal | Science 293 (5532), 1107-1112 (2001) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |