• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA.


RefSeq Accession Definition Services Price Order
NM_032387 Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA. ORF Sequence $1306.20
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_032387.4, 260166636
Length 4194 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA.
Product serine/threonine-protein kinase WNK4
Comment

Summary: This gene encodes a member of the WNK family of serine-threonine protein kinases. The kinase is part of the tight junction complex in kidney cells, and regulates the balance between NaCl reabsorption and K(+) secretion. The kinase regulates the activities of several types of ion channels, cotransporters, and exchangers involved in electrolyte flux in epithelial cells. Mutations in this gene result in pseudohypoaldosteronism type IIB.[provided by RefSeq, Sep 2009].

RefSeq NP_115763.2
CDS 69..3800
Misc Feature(1)603..1364
Misc Feature(2)603..1364
Misc Feature(3)606..1355
Misc Feature(4)order(606..620,630..632,669..671,675..677,768..770,
Misc Feature(5)order(606..620,630..632,669..671,675..677,768..770,
Misc Feature(6)order(618..620,849..851,855..857,972..974,978..980,
Misc Feature(7)order(1026..1046,1080..1091)
Misc Feature(8)1425..1535
Exon (1)1..686
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (2)687..859
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (3)860..1080
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (4)1081..1238
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (5)1239..1327
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (6)1328..1544
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (7)1545..1809
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (8)1810..1931
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (9)1932..1990
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (10)1991..2108
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (11)2109..2225
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (12)2226..2363
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (13)2364..2418
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (14)2419..3029
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (15)3030..3090
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (16)3091..3499
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (17)3500..3699
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (18)3700..3797
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Exon (19)3798..4178
Gene:WNK4
Gene Synonym:PHA2B; PRKWNK4
Translation MLASPATETTVLMSQTEADLALRPPPPLGTAGQPRLGPPPRRARRFSGKAEPRPRSSRLS RRSSVDLGLLSSWSLPASPAPDPPDPPDSAGPGPARSPPPSSKEPPEGTWTEGAPVKAAE DSARPELPDSAVGPGSREPLRVPEAVALERRREQEEKEDMETQAVATSPDGRYLKFDIEI GRGSFKTVYRGLDTDTTVEVAWCELQTRKLSRAERQRFSEEVEMLKGLQHPNIVRFYDSW KSVLRGQVCIVLVTELMTSGTLKTYLRRFREMKPRVLQRWSRQILRGLHFLHSRVPPILH RDLKCDNVFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDEAVDVYA FGMCMLEMATSEYPYSECQNAAQIYRKVTSGRKPNSFHKVKIPEVKEIIEGCIRTDKNER FTIQDLLAHAFFREERGVHVELAEEDDGEKPGLKLWLRMEDARRGGRPRDNQAIEFLFQL GRDAAEEVAQEMVALGLVCEADYQPVARAVRERVAAIQRKREKLRKARELEALPPEPGPP PATVPMAPGPPSVFPPEPEEPEADQHQPFLFRHASYSSTTSDCETDGYLSSSGFLDASDP ALQPPGGVPSSLAESHLCLPSAFALSIPRSGPGSDFSPGDSYASDAASGLSDVGEGMGQM RRPPGRNLRRRPRSRLRVTSVSDQNDRVVECQLQTHNSKMVTFRFDLDGDSPEEIAAAMV YNEFILPSERDGFLRRIREIIQRVETLLKRDTGPMEAAEDTLSPQEEPAPLPALPVPLPD PSNEELQSSTSLEHRSWTAFSTSSSSPGTPLSPGNPFSPGTPISPGPIFPITSPPCHPSP SPFSPISSQVSSNPSPHPTSSPLPFSSSTPEFPVPLSQCPWSSLPTTSPPTFSPTCSQVT LSSPFFPPCPSTSSFPSTTAAPLLSLASAFSLAVMTVAQSLLSPSPGLLSQSPPAPPSPL PSLPLPPPVAPGGQESPSPHTAEVESEASPPPARPLPGEARLAPISEEGKPQLVGRFQVT SSKEPAEPLPLQPTSPTLSGSPKPSTPQLTSESSDTEDSAGGGPETREALAESDRAAEGL GAGVEEEGDDGKEPQVGGSPQPLSHPSPVWMNYSYSSLCLSSEESESSGEDEEFWAELQS LRQKHLSEVETLQTLQKKEIEDLYSRLGKQPPPGIVAPAAMLSSRQRRLSKGSFPTSRRN SLQRSEPPGPGIMRRNSLSGSSTGSQEQRASKGVTFAGDVGRM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
47+dbSNP:
47+c, tdbSNP:200318202
51+g, tdbSNP:61754323
62+a, cdbSNP:202057094
84+a, gdbSNP:61754324
115+c, tdbSNP:61754325
231+c, tdbSNP:201419013
272+a, gdbSNP:200209645
307+a, cdbSNP:61754326
336+g, tdbSNP:199712166
365+g, tdbSNP:61754327
509+c, gdbSNP:112188737
526+a, gdbSNP:78058990
542+a, gdbSNP:146717828
561+g, tdbSNP:140344387
569+a, gdbSNP:201054911
575+a, cdbSNP:61754328
690+dbSNP:
690+c, tdbSNP:201212813
719+c, tdbSNP:146515383
747+g, tdbSNP:140897013
749+c, gdbSNP:75749468
750+c, gdbSNP:75596106
784+c, gdbSNP:199775692
798+c, tdbSNP:78232600
844+c, tdbSNP:138156012
845+a, gdbSNP:149157215
904+dbSNP:
904+a, gdbSNP:112475091
946+c, gdbSNP:146556309
950+a, gdbSNP:201337475
1001+a, gdbSNP:200256086
1005+c, gdbSNP:139202412
1013+c, tdbSNP:61754348
1053+c, tdbSNP:142280606
1117..1118+dbSNP:
1117..1118+, adbSNP:72024156
1123+a, cdbSNP:76310211
1170+a, gdbSNP:147522675
1238+g, tdbSNP:148161064
1265+dbSNP:
1265+a, gdbSNP:183280336
1361+dbSNP:
1361+c, tdbSNP:142027397
1397+a, gdbSNP:55772936
1420+c, tdbSNP:61754356
1462+a, gdbSNP:145499777
1553+dbSNP:
1553+a, gdbSNP:184632930
1578+c, tdbSNP:200593980
1590+c, tdbSNP:201947637
1591+a, gdbSNP:55997156
1592+c, tdbSNP:55879206
1594+c, tdbSNP:143222801
1599+c, tdbSNP:146216767
1622+a, gdbSNP:61755589
1624+a, gdbSNP:139245311
1640+g, tdbSNP:144084546
1641+c, tdbSNP:145020225
1642+a, gdbSNP:200182836
1666+c, tdbSNP:112963672
1709+c, tdbSNP:9916754
1712+c, tdbSNP:142230858
1721+c, tdbSNP:55751736
1728+a, tdbSNP:201848994
1732+c, gdbSNP:57737815
1734+a, c, gdbSNP:56003090
1747+a, gdbSNP:193922734
1750+c, tdbSNP:193922735
1752+a, gdbSNP:137853093
1758+c, gdbSNP:193922736
1759+a, cdbSNP:137853094
1761+c, gdbSNP:137853092
1781+c, tdbSNP:147902383
1787+c, tdbSNP:56243382
1831+dbSNP:
1831+a, cdbSNP:147084604
1868+, tdbSNP:61755595
1869+g, tdbSNP:55781437
1886+a, gdbSNP:149633706
1895+a, gdbSNP:201340788
1921+g, tdbSNP:143396070
1933+dbSNP:
1933+c, gdbSNP:201356607
1953+c, tdbSNP:61755600
1956+c, tdbSNP:56030257
1977..1978+, cdbSNP:35772851
1983+a, gdbSNP:61755602
1986+a, gdbSNP:199767685
2074+dbSNP:
2074+a, gdbSNP:146190504
2091+c, tdbSNP:61755604
2092+a, gdbSNP:202162490
2097+c, tdbSNP:9896991
2099+a, gdbSNP:201748544
2148+dbSNP:
2148+c, tdbSNP:142471423
2179+a, gdbSNP:150554297
2230+dbSNP:
2230+a, gdbSNP:140819480
2275+a, gdbSNP:149389156
2281+a, gdbSNP:200823152
2287+c, tdbSNP:201510716
2292+c, gdbSNP:189584917
2296+a, gdbSNP:139570279
2346+a, gdbSNP:200807433
2394+dbSNP:
2394+a, gdbSNP:200438705
2402+c, tdbSNP:61755621
2408+a, cdbSNP:199864937
2416+a, gdbSNP:145613797
2432+dbSNP:
2432+c, tdbSNP:56376863
2437+a, cdbSNP:56227191
2450+c, gdbSNP:56231972
2452+c, gdbSNP:185780530
2460+a, tdbSNP:61755624
2473+a, cdbSNP:35725557
2491+c, gdbSNP:147081637
2542+c, tdbSNP:56226218
2544+a, gdbSNP:190384194
2549+c, tdbSNP:200744992
2637+c, tdbSNP:61755626
2739+a, gdbSNP:141615112
2740+c, tdbSNP:56081375
2741+a, gdbSNP:151077943
2792+c, tdbSNP:2290042
2820+a, gdbSNP:200057224
2833+c, tdbSNP:201592842
2858+c, tdbSNP:201032525
2905+c, gdbSNP:200187290
2949+a, gdbSNP:2290041
2961+c, tdbSNP:200640984
2972+c, tdbSNP:138944002
2973+a, gdbSNP:202060087
3077+dbSNP:
3077+a, gdbSNP:142279974
3100+dbSNP:
3100+c, gdbSNP:61755628
3123+g, tdbSNP:201925752
3142+c, tdbSNP:56099549
3250+c, gdbSNP:142406282
3291+c, tdbSNP:201421543
3292+a, gdbSNP:200263366
3295+c, tdbSNP:143956890
3319+c, tdbSNP:148648427
3464+a, gdbSNP:150858674
3548+dbSNP:
3548+g, tdbSNP:201060010
3558+c, tdbSNP:141257205
3573+a, gdbSNP:193922737
3586+a, cdbSNP:117902541
3621+c, tdbSNP:137853095
3622+a, gdbSNP:61755631
3661+a, gdbSNP:61755632
3663+a, cdbSNP:200519604
3678+c, tdbSNP:56116165
3729+dbSNP:
3729+a, gdbSNP:201075094
3806+dbSNP:
3806+a, gdbSNP:61755635
3814+a, gdbSNP:202219527
3910+a, cdbSNP:200888932
3975+a, gdbSNP:191035468
4057+a, gdbSNP:111588847
4135+c, gdbSNP:61755636
Gene SymbolWNK4
Gene SynonymPHA2B; PRKWNK4
Chromosome17
Locus Map17q21-q22
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_032387 Homo sapiens WNK lysine deficient protein kinase 4 (WNK4), mRNA. Full Length $1467.90
ORF Sequence $1306.20
Title Disease-causing R1185C mutation of WNK4 disrupts a regulatory mechanism involving calmodulin binding and SGK1 phosphorylation sites .
Author Na,T., Wu,G., Zhang,W., Dong,W.J. and Peng,J.B.
Journal Am. J. Physiol. Renal Physiol. 304 (1), F8-F18 (2013)
Title Antagonistic regulation of cystic fibrosis transmembrane conductance regulator cell surface expression by protein kinases WNK4 and spleen tyrosine kinase .
Author Mendes,A.I., Matos,P., Moniz,S., Luz,S., Amaral,M.D., Farinha,C.M. and Jordan,P.
Journal Mol. Cell. Biol. 31 (19), 4076-4086 (2011)
Title Hypertension associated polymorphisms in WNK1/WNK4 are not associated with hydrochlorothiazide response .
Author Han,Y., Fan,X., Sun,K., Wang,X., Wang,Y., Chen,J., Zhen,Y., Zhang,W. and Hui,R.
Journal Clin. Biochem. 44 (13), 1045-1049 (2011)
Title WNK4 kinase inhibits Maxi K channel activity by a kinase-dependent mechanism .
Author Zhuang,J., Zhang,X., Wang,D., Li,J., Zhou,B., Shi,Z., Gu,D., Denson,D.D., Eaton,D.C. and Cai,H.
Journal Am. J. Physiol. Renal Physiol. 301 (2), F410-F419 (2011)
Title WNK4 regulates apical and basolateral Cl- flux in extrarenal epithelia .
Author Kahle,K.T., Gimenez,I., Hassan,H., Wilson,F.H., Wong,R.D., Forbush,B., Aronson,P.S. and Lifton,R.P.
Journal Proc. Natl. Acad. Sci. U.S.A. 101 (7), 2064-2069 (2004)
Title Genetic variants of WNK4 in whites and African Americans with hypertension .
Author Erlich,P.M., Cui,J., Chazaro,I., Farrer,L.A., Baldwin,C.T., Gavras,H. and DeStefano,A.L.
Journal Hypertension 41 (6), 1191-1195 (2003)
Title Molecular pathogenesis of inherited hypertension with hyperkalemia: the Na-Cl cotransporter is inhibited by wild-type but not mutant WNK4 .
Author Wilson,F.H., Kahle,K.T., Sabath,E., Lalioti,M.D., Rapson,A.K., Hoover,R.S., Hebert,S.C., Gamba,G. and Lifton,R.P.
Journal Proc. Natl. Acad. Sci. U.S.A. 100 (2), 680-684 (2003)
Title Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants .
Author Wistow,G., Bernstein,S.L., Wyatt,M.K., Fariss,R.N., Behal,A., Touchman,J.W., Bouffard,G., Smith,D. and Peterson,K.
Journal Mol. Vis. 8, 205-220 (2002)
Title WNK kinases, a novel protein kinase subfamily in multi-cellular organisms .
Author Verissimo,F. and Jordan,P.
Journal Oncogene 20 (39), 5562-5569 (2001)
Title Human hypertension caused by mutations in WNK kinases .
Author Wilson,F.H., Disse-Nicodeme,S., Choate,K.A., Ishikawa,K., Nelson-Williams,C., Desitter,I., Gunel,M., Milford,D.V., Lipkin,G.W., Achard,J.M., Feely,M.P., Dussol,B., Berland,Y., Unwin,R.J., Mayan,H., Simon,D.B., Farfel,Z., Jeunemaitre,X. and Lifton,R.P.
Journal Science 293 (5532), 1107-1112 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878