• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens PTEN induced putative kinase 1 (PINK1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25380 Homo sapiens PTEN induced putative kinase 1 (PINK1), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu25380C Homo sapiens PTEN induced putative kinase 1 (PINK1), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_032409.2, 112382374
Length 1746 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens PTEN induced putative kinase 1 (PINK1), mRNA.
Product serine/threonine-protein kinase PINK1, mitochondrial precursor
Comment

Summary: This gene encodes a serine/threonine protein kinase that localizes to mitochondria. It is thought to protect cells from stress-induced mitochondrial dysfunction. Mutations in this gene cause one form of autosomal recessive early-onset Parkinson disease. [provided by RefSeq, Jul 2008].

RefSeq NP_115785.1
CDS 95..1840
Misc Feature(1)374..424
Misc Feature(2)776..778
Misc Feature(3)<905..1597
Misc Feature(4)order(917..919,1046..1057,1064..1066,1070..1072,
Misc Feature(5)order(917..919,1046..1057,1064..1066,1178..1180,
Misc Feature(6)order(1064..1066,1070..1072,1178..1180,1184..1186,
Misc Feature(7)order(1241..1261,1319..1330)
Misc Feature(8)1298..1300
Exon (1)1..481
Gene:PINK1
Gene Synonym:BRPK; PARK6
Exon (2)482..769
Gene:PINK1
Gene Synonym:BRPK; PARK6
Exon (3)770..870
Gene:PINK1
Gene Synonym:BRPK; PARK6
Exon (4)871..1053
Gene:PINK1
Gene Synonym:BRPK; PARK6
Exon (5)1054..1217
Gene:PINK1
Gene Synonym:BRPK; PARK6
Exon (6)1218..1345
Gene:PINK1
Gene Synonym:BRPK; PARK6
Exon (7)1346..1582
Gene:PINK1
Gene Synonym:BRPK; PARK6
Exon (8)1583..2660
Gene:PINK1
Gene Synonym:BRPK; PARK6
Translation MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGERPGWAAGPGAEPRRVG LGLPNRLRFFRQSVAGLAARLQRQFVVRAWGCAGPCGRAVFLAFGLGLGLIEEKQAESRR AVSACQEIQAIFTQKSKPGPDPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQ NLEVTKSTGLLPGRGPGTSAPGEGQERAPGAPAFPLAIKMMWNISAGSSSEAILNTMSQE LVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLP SRLHPEGLGHGRTLFLVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGVDHLVQQGIAH RDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVST ARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALPESVPP DVRQLVRALLQREASKRPSARVAANVLHLSLWGEHILALKNLKLDKMVGWLLQQSAATLL ANRLTEKCCVETKMKMLFLANLECETLCQAALLLCSWRAAL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
263..479+c, tdbSNP:45630563
263..438+a, tdbSNP:45540544
283+c, tdbSNP:45530340
312+c, tdbSNP:202048763
438+a, tdbSNP:148871409
492+dbSNP:
492+c, tdbSNP:374891130
516+a, gdbSNP:369569239
520+a, gdbSNP:151146709
528+c, tdbSNP:45604240
529+a, gdbSNP:370346526
534+a, gdbSNP:138050841
537+g, tdbSNP:56297806
548+c, tdbSNP:45608139
568+a, gdbSNP:374204111
604+a, gdbSNP:376964979
650+a, gdbSNP:371385940
652+c, gdbSNP:143204084
680+c, tdbSNP:35802484
681+c, tdbSNP:138302371
690+c, gdbSNP:374547622
693+c, tdbSNP:149822257
708+a, gdbSNP:367628601
709+a, gdbSNP:368459102
719+c, gdbSNP:17852513
720+c, tdbSNP:34677717
725+a, gdbSNP:201885172
733+c, tdbSNP:139649940
738+c, g, tdbSNP:371854396
744+a, cdbSNP:74315360
772+dbSNP:
772+a, gdbSNP:200024387
773+c, gdbSNP:45545034
774+g, tdbSNP:138018628
784+c, tdbSNP:367947092
789+c, tdbSNP:144071530
830+c, tdbSNP:74315357
831+a, gdbSNP:375601968
835+a, gdbSNP:149750658
839+g, tdbSNP:145650643
864+c, tdbSNP:370906995
896+dbSNP:
896+c, gdbSNP:372280083
898+a, gdbSNP:200708848
907+a, cdbSNP:28940284
929+c, tdbSNP:61735932
930+a, gdbSNP:74315358
938+a, tdbSNP:200036561
945+a, cdbSNP:113092523
946+c, tdbSNP:368453193
951+c, tdbSNP:146691996
952+a, gdbSNP:148144773
958+a, gdbSNP:369566143
963+a, gdbSNP:181675228
974+a, gdbSNP:373473255
999+a, gdbSNP:201940147
1007+c, gdbSNP:112600292
complement(1008)-t, cdbSNP:7349186
1015+c, tdbSNP:200191396
1017+a, tdbSNP:398124659
1020+a, gdbSNP:74315355
1023+a, gdbSNP:375197494
1029+a, gdbSNP:202128685
1030+a, gdbSNP:56200357
1032+c, tdbSNP:74315359
1033+a, gdbSNP:142866598
1036+a, gdbSNP:145990823
1042+c, tdbSNP:142183624
1043+a, gdbSNP:200949139
1046+a, tdbSNP:139226733
1060+dbSNP:
1060+c, gdbSNP:199678436
1062+a, gdbSNP:373417787
1070+c, tdbSNP:376323248
1071+a, gdbSNP:142028165
1097+a, gdbSNP:144330127
1104+a, gdbSNP:184043309
1105+c, tdbSNP:149187537
1109+a, gdbSNP:55831733
1112+a, gdbSNP:3738136
1117+a, gdbSNP:35813094
1129+g, tdbSNP:201920474
1134+c, tdbSNP:28940285
1159+a, gdbSNP:370470902
1169+a, gdbSNP:76753586
1171+a, gdbSNP:144550985
1190+a, gdbSNP:200729715
1224+dbSNP:
1224+g, tdbSNP:34203620
1234+a, gdbSNP:55962214
1241+a, gdbSNP:45515602
1253+g, tdbSNP:200462866
1267+c, tdbSNP:45499398
1272+c, gdbSNP:368939214
1276+c, tdbSNP:373528661
1280+c, tdbSNP:368216507
1283+c, tdbSNP:139094526
1290+c, tdbSNP:119451946
1299+a, gdbSNP:200728364
1307+a, gdbSNP:145821082
1313+c, tdbSNP:145876364
1325+a, gdbSNP:45478900
1330+g, tdbSNP:374657174
1331+c, gdbSNP:202130946
1358+dbSNP:
1358+c, tdbSNP:374167096
1359+a, gdbSNP:201491485
1385+c, tdbSNP:74315361
1389+a, gdbSNP:368438636
1393+a, gdbSNP:371775590
1394+a, gdbSNP:374910091
1405+a, gdbSNP:74315356
1407+c, tdbSNP:183454580
1413+a, gdbSNP:45467995
1415+a, gdbSNP:369043567
1421+a, gdbSNP:148313557
1422+c, tdbSNP:138135040
1425+a, gdbSNP:143659957
1435+c, tdbSNP:140652495
1456+c, tdbSNP:56383368
1459+c, gdbSNP:369112191
1460+c, tdbSNP:45539432
1461+a, gdbSNP:150964528
1465+c, gdbSNP:199705273
1474+c, tdbSNP:369755617
1476+g, tdbSNP:144440543
1493+c, gdbSNP:373657922
1499..1520+a, gdbSNP:45499196
1519+c, tdbSNP:150183401
1520+a, gdbSNP:115477764
1523+a, tdbSNP:34416410
1536+a, tdbSNP:376829940
1568+c, tdbSNP:34208370
1569+a, gdbSNP:143620063
1582+a, gdbSNP:56217826
1596+dbSNP:
1596+a, gdbSNP:61744200
1624+c, tdbSNP:367949045
1638+a, gdbSNP:141363209
1643+c, tdbSNP:149466252
1656+a, cdbSNP:1043424
1670+a, gdbSNP:371338035
1698+c, tdbSNP:146126901
1699+a, gdbSNP:149070918
1715+g, tdbSNP:61749520
1813+c, tdbSNP:201936304
1822+a, gdbSNP:149994404
1849+c, tdbSNP:200804593
1858+a, gdbSNP:369117599
1877+a, tdbSNP:686658
1880+a, gdbSNP:115768147
1894+a, gdbSNP:142119718
2019+c, tdbSNP:11554543
2021+c, gdbSNP:513414
2036+c, tdbSNP:1043443
2105+c, g, tdbSNP:512550
2108+a, tdbSNP:2320395
2189+c, gdbSNP:114112086
2235+a, tdbSNP:372830163
complement(2255)-g, cdbSNP:8064
2269+g, tdbSNP:147759776
2326+a, cdbSNP:369053717
2330+a, cdbSNP:16824318
2367..2370+, agtadbSNP:138181538
2372+a, gdbSNP:190393061
2381..2382+, aagtdbSNP:3077906
2385+a, gdbSNP:193299196
2404+g, tdbSNP:1043502
2407+c, gdbSNP:11554544
2410..2411+, ctgadbSNP:143763511
2411..2412+, ctgadbSNP:71797656
2416..2417+, gactdbSNP:375956041
2426+c, tdbSNP:184877436
2467+a, gdbSNP:112126165
complement(2495)-t, cdbSNP:141140099
2510..2511+, ttcdbSNP:33999970
2511..2512+, ctt, t, ttcdbSNP:71760582
2512+c, tdbSNP:2078073
2512+c, tcttdbSNP:67252247
2515..2516+, cttdbSNP:3077908
2557+c, tdbSNP:181532922
2562..2563+, aagdbSNP:34119921
2563..2564+, agag, gdbSNP:34361349
2564..2565+, agag, gagadbSNP:3077910
2568..2569+, gagadbSNP:398069438
2576..2577+, ctaadbSNP:113674347
2577+a, cdbSNP:185791919
2590..2591+, aactdbSNP:372726829
2647+c, tdbSNP:78349864
Gene SymbolPINK1
Gene SynonymBRPK; PARK6
Chromosome1
Locus Map1p36
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_032409 Homo sapiens PTEN induced putative kinase 1 (PINK1), mRNA. On-demand TBD TBD
Title Beyond the mitochondrion: cytosolic PINK1 remodels dendrites through protein kinase A .
Author Dagda RK, Pien I, Wang R, Zhu J, Wang KZ, Callio J, Banerjee TD, Dagda RY and Chu CT.
Journal J. Neurochem. 128 (6), 864-877 (2014)
Title Parkin and PINK1 function in a vesicular trafficking pathway regulating mitochondrial quality control .
Author McLelland GL, Soubannier V, Chen CX, McBride HM and Fon EA.
Journal EMBO J. 33 (4), 282-295 (2014)
Title A dimeric PINK1-containing complex on depolarized mitochondria stimulates Parkin recruitment .
Author Okatsu K, Uno M, Koyano F, Go E, Kimura M, Oka T, Tanaka K and Matsuda N.
Journal J. Biol. Chem. 288 (51), 36372-36384 (2013)
Title The BAG2 protein stabilises PINK1 by decreasing its ubiquitination .
Author Che,X., Tang,B., Wang,X., Chen,D., Yan,X., Jiang,H., Shen,L., Xu,Q., Wang,G. and Guo,J.
Journal Biochem. Biophys. Res. Commun. 441 (2), 488-492 (2013)
Title Clinical and subclinical dopaminergic dysfunction in PARK6-linked parkinsonism: an 18F-dopa PET study .
Author Khan NL, Valente EM, Bentivoglio AR, Wood NW, Albanese A, Brooks DJ and Piccini P.
Journal Ann. Neurol. 52 (6), 849-853 (2002)
Title Autosomal recessive early onset parkinsonism is linked to three loci: PARK2, PARK6, and PARK7 .
Author Bonifati V, Dekker MC, Vanacore N, Fabbrini G, Squitieri F, Marconi R, Antonini A, Brustenghi P, Dalla Libera A, De Mari M, Stocchi F, Montagna P, Gallai V, Rizzu P, van Swieten JC, Oostra B, van Duijn CM, Meco G and Heutink P.
Journal Neurol. Sci. 23 (SUPPL 2), S59-S60 (2002)
Title Growth-suppressive effects of BPOZ and EGR2, two genes involved in the PTEN signaling pathway .
Author Unoki M and Nakamura Y.
Journal Oncogene 20 (33), 4457-4465 (2001)
Title Localization of a novel locus for autosomal recessive early-onset parkinsonism, PARK6, on human chromosome 1p35-p36 .
Author Valente EM, Bentivoglio AR, Dixon PH, Ferraris A, Ialongo T, Frontali M, Albanese A and Wood NW.
Journal Am. J. Hum. Genet. 68 (4), 895-900 (2001)
Title PINK1 Type of Young-Onset Parkinson Disease .
Author Schneider,S.A. and Klein,C.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Parkinson Disease Overview .
Author Farlow,J., Pankratz,N.D., Wojcieszek,J. and Foroud,T.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.