• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens SLX4 structure-specific endonuclease subunit (SLX4), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18199 Homo sapiens SLX4 structure-specific endonuclease subunit (SLX4), mRNA. pcDNA3.1+-DYK On-demand $2699.00 30
OHu18199C Homo sapiens SLX4 structure-specific endonuclease subunit (SLX4), mRNA. Customized vector On-demand $2699.00 30

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_032444.2, 63252862
Length 5505 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens SLX4 structure-specific endonuclease subunit (SLX4), mRNA.
Product structure-specific endonuclease subunit SLX4
Comment

Summary: This gene encodes a structure-specific endonuclease subunit. The encoded protein contains a central BTB domain and it forms a multiprotein complex with the ERCC4(XPF)-ERCC1, MUS81-EME1, and SLX1 endonucleases, and also associates with MSH2/MSH3 mismatch repair complex, telomere binding complex TERF2(TRF2)-TERF2IP(RAP1), the protein kinase PLK1 and the uncharacterized protein C20orf94. The multiprotein complex is required for repair of specific types of DNA lesions and is critical for cellular responses to replication fork failure. The encoded protein acts as a docking platform for the assembly of multiple structure-specific endonucleases.[provided by RefSeq, Jan 2011].

RefSeq NP_115820.2
CDS 628..6132
Misc Feature(1)613..615
Misc Feature(2)628..2634
Misc Feature(3)628..2634
Misc Feature(4)1486..1488
Misc Feature(5)2677..6129
Misc Feature(6)2722..2991
Misc Feature(7)3757..3759
Misc Feature(8)4609..5571
Misc Feature(9)5032..5034
Misc Feature(10)5521..6129
Misc Feature(11)5881..6060
Exon (1)1..25
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (2)26..1162
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (3)1163..1387
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (4)1388..1577
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (5)1578..1790
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (6)1791..1993
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (7)1994..2310
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (8)2311..2551
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (9)2552..2640
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (10)2641..2787
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (11)2788..2954
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (12)2955..5263
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (13)5264..5366
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (14)5367..5780
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (15)5781..7293
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Translation MKLSVNEAQLGFYLGSLSHLSACPGIDPRSSEDQPESLKTGQMMDESDEDFKELCASFFQ RVKKHGIKEVSGERKTQKAASNGTQIRSKLKRTKQTATKTKTLQGPAEKKPPSGSQAPRT KKQRVTKWQASEPAHSVNGEGGVLASAPDPPVLRETAQNTQTGNQQEPSPNLSREKTREN VPNSDSQPPPSCLTTAVPSPSKPRTAQLVLQRMQQFKRADPERLRHASEECSLEAAREEN VPKDPQEEMMAGNVYGLGPPAPESDAAVALTLQQEFARVGASAHDDSLEEKGLFFCQICQ KNLSAMNVTRREQHVNRCLDEAEKTLRPSVPQIPECPICGKPFLTLKSRTSHLKQCAVKM EVGPQLLLQAVRLQTAQPEGSSSPPMFSFSDHSRGLKRRGPTSKKEPRKRRKVDEAPSED LLVAMALSRSEMEPGAAVPALRLESAFSERIRPEAENKSRKKKPPVSPPLLLVQDSETTG RQIEDRVALLLSEEVELSSTPPLPASRILKEGWERAGQCPPPPERKQSFLWEGSALTGAW AMEDFYTARLVPPLVPQRPAQGLMQEPVPPLVPPEHSELSERRSPALHGTPTAGCGSRGP SPSASQREHQALQDLVDLAREGLSASPWPGSGGLAGSEGTAGLDVVPGGLPLTGFVVPSQ DKHPDRGGRTLLSLGLLVADFGAMVNNPHLSDVQFQTDSGEVLYAHKFVLYARCPLLIQY VNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVS ELVHLCEQVPIATDSEGKPWEEKEAENCESRAENFQELLRSMWADEEEEAETLLKSKDHE EDQENVNEAEMEEIYEFAATQRKLLQEERAAGAGEDADWLEGGSPVSGQLLAGVQVQKQW DKVEEMEPLEPGRDEAATTWEKMGQCALPPPQGQHSGARGAEAPEQEAPEEALGHSSCSS PSRDCQAERKEGSLPHSDDAGDYEQLFSSTQGEISEPSQITSEPEEQSGAVRERGLEVSH RLAPWQASPPHPCRFLLGPPQGGSPRGSHHTSGSSLSTPRSRGGTSQVGSPTLLSPAVPS KQKRDRSILTLSKEPGHQKGKERRSVLECRNKGVLMFPEKSPSIDLTQSNPDHSSSRSQK SSSKLNEEDEVILLLDSDEELELEQTKMKSISSDPLEEKKALEISPRSCELFSIIDVDAD QEPSQSPPRSEAVLQQEDEGALPENRGSLGRRGAPWLFCDRESSPSEASTTDTSWLVPAT PLASRSRDCSSQTQISSLRSGLAVQAVTQHTPRASVGNREGNEVAQKFSVIRPQTPPPQT PSSCLTPVSPGTSDGRRQGHRSPSRPHPGGHPHSSPLAPHPISGDRAHFSRRFLKHSPPG PSFLNQTPAGEVVEVGDSDDEQEVASHQANRSPPLDSDPPIPIDDCCWHMEPLSPIPIDH WNLERTGPLSTSSPSRRMNEAADSRDCRSPGLLDTTPIRGSCTTQRKLQEKSSGAGSLGN SRPSFLNSALWDVWDGEEQRPPETPPPAQMPSAGGAQKPEGLETPKGANRKKNLPPKVPI TPMPQYSIMETPVLKKELDRFGVRPLPKRQMVLKLKEIFQYTHQTLDSDSEDESQSSQPL LQAPHCQTLASQTYKPSRAGVHAQQEATTGPGAHRPKGPAKTKGPRHQRKHHESITPPSR SPTKEAPPGLNDDAQIPASQESVATSVDGSDSSLSSQSSSSCEFGAAFESAGEEEGEGEV SASQAAVQAADTDEALRCYIRSKPALYQKVLLYQPFELRELQAELRQNGLRVSSRRLLDF LDTHCITFTTAATRREKLQGRRRQPRGKKKVERN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(8)-dbSNP:
complement(8)-t, cdbSNP:369969679
complement(188)-dbSNP:
complement(188)-g, adbSNP:377618578
complement(247)-t, cdbSNP:375326827
complement(269)-g, cdbSNP:57910835
complement(313)-g, adbSNP:368739206
complement(333)-t, cdbSNP:59311338
complement(357)-t, cdbSNP:149773885
complement(417..418)-, gdbSNP:149138178
complement(430)-, tdbSNP:146273887
complement(462)-g, adbSNP:370235531
complement(485..488)-, tgttdbSNP:376510182
complement(524)-t, cdbSNP:73505426
complement(553)-t, cdbSNP:182545721
complement(582)-t, cdbSNP:113023461
complement(596)-t, gdbSNP:369594209
complement(607)-g, cdbSNP:200717103
complement(609)-t, cdbSNP:113845637
complement(623)-g, adbSNP:370748316
complement(635)-c, adbSNP:377532371
complement(683)-t, cdbSNP:373569281
complement(685)-g, adbSNP:146667545
687+a, gdbSNP:200430973
complement(700)-t, cdbSNP:201533738
complement(710)-g, cdbSNP:370378391
complement(712)-g, adbSNP:144832924
complement(713)-t, cdbSNP:149117119
complement(716)-g, adbSNP:373743309
complement(717)-g, adbSNP:118089506
complement(734)-t, adbSNP:370082083
complement(738)-t, gdbSNP:188729744
complement(739)-g, adbSNP:141167501
complement(762)-g, adbSNP:146582790
complement(772)-t, cdbSNP:139757085
complement(792)-g, adbSNP:202030834
complement(815)-t, cdbSNP:147706467
complement(816)-t, gdbSNP:28612736
complement(820)-g, adbSNP:145345695
complement(844)-g, cdbSNP:139829211
complement(857)-t, cdbSNP:147458405
complement(858)-t, cdbSNP:143279888
complement(864)-g, adbSNP:375620914
871+a, gdbSNP:202237877
874+a, gdbSNP:200319106
complement(885)-t, cdbSNP:112205823
926+a, cdbSNP:201163062
complement(963)-t, cdbSNP:79126454
complement(966)-g, adbSNP:144326379
complement(993)-t, cdbSNP:149626570
complement(998)-g, cdbSNP:200113605
complement(1025)-g, adbSNP:373586019
complement(1048)-c, adbSNP:137976282
complement(1049)-c, adbSNP:77306735
complement(1050)-c, adbSNP:111405249
complement(1052)-t, cdbSNP:369420246
complement(1053)-t, adbSNP:377500336
complement(1067)-g, adbSNP:375834712
complement(1072)-t, cdbSNP:372449620
1079+c, tdbSNP:200191906
complement(1087)-g, adbSNP:141639275
complement(1092)-t, cdbSNP:138512851
complement(1094)-t, gdbSNP:144614070
complement(1112)-g, adbSNP:140876043
complement(1116)-c, adbSNP:201211891
complement(1126)-t, cdbSNP:151018140
1180+dbSNP:
1180+a, gdbSNP:201769293
complement(1182)-g, adbSNP:74640850
complement(1206)-t, cdbSNP:148887586
complement(1217)-g, adbSNP:147826749
complement(1237)-g, adbSNP:79842542
complement(1237)-g, adbSNP:386477922
complement(1253)-g, adbSNP:201985764
complement(1258)-g, cdbSNP:375296302
complement(1276)-t, cdbSNP:377519438
complement(1290)-g, adbSNP:373341628
complement(1305)-g, adbSNP:28516461
complement(1306)-t, cdbSNP:147872182
complement(1323)-t, gdbSNP:147387334
complement(1327)-t, cdbSNP:149779179
complement(1329)-g, cdbSNP:201161027
1334+c, tdbSNP:200803578
complement(1336)-g, adbSNP:199912910
complement(1337)-t, cdbSNP:138615800
complement(1339)-t, cdbSNP:150703293
complement(1345)-t, cdbSNP:114744903
1361+c, tdbSNP:199929086
complement(1369)-t, cdbSNP:148547201
complement(1379)-g, adbSNP:201117707
complement(1380)-t, cdbSNP:8061528
complement(1419)-dbSNP:
complement(1419)-g, adbSNP:201383482
complement(1420)-t, cdbSNP:368377000
complement(1428)-t, cdbSNP:375643423
complement(1459)-g, adbSNP:141597706
1460+a, gdbSNP:201192909
complement(1472)-g, adbSNP:138618354
complement(1527)-t, cdbSNP:373867005
complement(1548)-g, adbSNP:370468973
complement(1600)-dbSNP:
complement(1600)-t, adbSNP:181942292
complement(1620)-t, adbSNP:369391369
complement(1623)-c, adbSNP:377201471
complement(1626)-g, adbSNP:7198338
complement(1637)-g, adbSNP:200363140
complement(1679)-t, cdbSNP:372790089
1692+a, gdbSNP:200183071
complement(1704)-c, adbSNP:149470704
complement(1736)-g, adbSNP:189224493
complement(1742)-t, cdbSNP:372956623
complement(1752)-t, cdbSNP:369510675
complement(1779)-t, cdbSNP:112511042
complement(1780)-t, gdbSNP:115694169
complement(1783)-t, cdbSNP:113490934
complement(1786)-c, adbSNP:373810042
complement(1789)-t, adbSNP:199774640
complement(1805)-dbSNP:
complement(1805)-t, cdbSNP:112301713
complement(1816)-t, cdbSNP:202204661
complement(1819)-g, adbSNP:138799572
complement(1820)-t, cdbSNP:200030312
complement(1850)-t, cdbSNP:377135500
complement(1859)-t, cdbSNP:201009985
complement(1866)-t, cdbSNP:374755757
complement(1870)-t, cdbSNP:146021821
complement(1880)-g, adbSNP:267604540
complement(1895)-g, adbSNP:371579487
complement(1909..1910)-, gdbSNP:35570194
complement(1913)-t, cdbSNP:141625470
complement(1917)-t, cdbSNP:201430172
complement(1935)-t, cdbSNP:147915773
complement(1940)-c, adbSNP:74553110
complement(1950)-g, adbSNP:373727514
complement(1998)-dbSNP:
complement(1998)-c, adbSNP:74319927
complement(1999)-t, cdbSNP:149126845
complement(2006)-t, cdbSNP:369994733
complement(2012)-t, cdbSNP:112133511
complement(2016)-t, cdbSNP:376668879
complement(2021)-g, adbSNP:372128800
complement(2049)-t, cdbSNP:181470615
complement(2064)-t, cdbSNP:376641868
complement(2069)-t, cdbSNP:145194745
complement(2075)-g, adbSNP:373381697
complement(2082)-t, gdbSNP:150053867
complement(2097)-g, adbSNP:139766312
complement(2117)-g, adbSNP:200337039
complement(2123)-g, cdbSNP:369280911
complement(2126)-g, adbSNP:377440877
complement(2174)-g, adbSNP:199683722
complement(2190)-g, adbSNP:146360238
complement(2200)-g, adbSNP:143831403
complement(2211)-g, cdbSNP:139865448
complement(2224)-g, cdbSNP:200437227
complement(2225)-t, cdbSNP:369243098
complement(2229)-g, adbSNP:201754095
complement(2254)-t, cdbSNP:377148341
complement(2264)-t, cdbSNP:150547487
2268+a, gdbSNP:200497436
complement(2278)-c, adbSNP:369137872
complement(2289)-g, adbSNP:375996119
complement(2299)-g, adbSNP:372264472
complement(2329)-dbSNP:
complement(2329)-t, cdbSNP:371825444
complement(2334)-t, cdbSNP:141687678
complement(2367)-g, adbSNP:200354014
complement(2368)-t, cdbSNP:200949593
complement(2376)-c, adbSNP:374644679
complement(2382)-t, g, adbSNP:114016359
complement(2391)-g, adbSNP:201638593
complement(2413)-t, cdbSNP:144454312
complement(2415)-g, adbSNP:371549347
complement(2429)-g, adbSNP:59706816
complement(2430)-t, cdbSNP:144892556
2459+a, cdbSNP:201641321
2472+a, cdbSNP:1056084
2473+a, gdbSNP:199863797
complement(2483)-g, adbSNP:371325486
complement(2484)-t, cdbSNP:375786206
complement(2500)-t, cdbSNP:200755122
complement(2515)-t, cdbSNP:376620029
2523+c, gdbSNP:200859735
2525+a, gdbSNP:1056085
complement(2537)-g, adbSNP:200475686
2538+a, gdbSNP:200013924
complement(2557)-dbSNP:
complement(2557)-t, cdbSNP:368699362
complement(2571)-g, adbSNP:149315267
complement(2603)-g, adbSNP:372150541
complement(2618)-g, adbSNP:369805557
complement(2632)-g, adbSNP:375524355
2633+a, gdbSNP:200807331
complement(2639)-g, adbSNP:77985244
complement(2649)-dbSNP:
complement(2649)-g, c, adbSNP:139900828
complement(2653)-g, adbSNP:199711185
complement(2661)-c, adbSNP:200278096
complement(2674)-t, cdbSNP:115866745
complement(2680)-t, cdbSNP:371002922
complement(2692)-g, adbSNP:138124860
complement(2706)-g, adbSNP:150206155
complement(2718)-t, cdbSNP:376325761
complement(2726)-t, cdbSNP:373081094
complement(2730)-g, cdbSNP:73505420
complement(2745)-g, adbSNP:371401752
complement(2752)-t, cdbSNP:151026877
complement(2821)-dbSNP:
complement(2821)-c, adbSNP:202189103
complement(2836)-g, cdbSNP:140706384
complement(2837)-t, cdbSNP:146901714
complement(2838)-g, adbSNP:113436106
complement(2853)-g, adbSNP:376261173
complement(2855)-g, adbSNP:1061002
complement(2862)-g, adbSNP:75184268
complement(2868)-g, adbSNP:143790956
complement(2869)-t, cdbSNP:373178144
complement(2873)-t, cdbSNP:140109914
complement(2876)-g, adbSNP:145353518
complement(2886)-g, cdbSNP:374294258
complement(2897)-g, adbSNP:149897636
complement(2917)-g, cdbSNP:151105762
complement(2932)-g, cdbSNP:150712805
complement(2941..2942)-, gdbSNP:34644639
complement(2948)-g, cdbSNP:376389326
complement(2959)-dbSNP:
complement(2959)-g, cdbSNP:142722925
complement(2986)-t, cdbSNP:140600202
complement(3005)-t, gdbSNP:377580582
complement(3008)-t, adbSNP:201622632
complement(3015)-t, cdbSNP:113965715
complement(3016)-t, cdbSNP:373595621
complement(3018)-g, adbSNP:147208178
complement(3076)-g, cdbSNP:143730668
complement(3084)-t, cdbSNP:148026020
complement(3111)-g, cdbSNP:199656607
complement(3211)-g, adbSNP:200715208
complement(3212)-t, cdbSNP:143558209
3224+a, cdbSNP:201539019
complement(3229)-t, cdbSNP:369377624
complement(3236)-g, adbSNP:149584080
complement(3239)-g, adbSNP:138259798
complement(3246)-g, adbSNP:376204133
complement(3247)-t, cdbSNP:113420526
complement(3248)-t, cdbSNP:150402424
complement(3250)-t, cdbSNP:372976873
complement(3255)-g, adbSNP:201279467
complement(3275)-t, cdbSNP:112994550
complement(3281)-g, adbSNP:147492092
complement(3294)-t, cdbSNP:146790631
complement(3308)-c, adbSNP:145137472
complement(3348)-c, adbSNP:141450907
complement(3357)-t, cdbSNP:151080921
complement(3373)-c, adbSNP:79448721
complement(3375)-g, adbSNP:374815885
complement(3376)-t, cdbSNP:148428054
complement(3383)-g, adbSNP:145533919
complement(3403)-g, adbSNP:201703364
complement(3405)-g, adbSNP:375872764
complement(3411)-g, adbSNP:372754390
complement(3413)-g, adbSNP:117707719
complement(3451)-g, cdbSNP:114014006
complement(3460)-t, cdbSNP:370212293
complement(3471)-t, cdbSNP:376877866
complement(3481)-t, cdbSNP:59939128
complement(3482)-g, adbSNP:78637028
complement(3489)-g, adbSNP:374738171
complement(3491)-t, cdbSNP:143694260
complement(3504)-g, adbSNP:139217437
complement(3513)-g, adbSNP:202053414
complement(3516)-t, cdbSNP:201978747
complement(3551)-g, adbSNP:114472821
complement(3554)-t, gdbSNP:141294497
complement(3585)-g, cdbSNP:148111699
complement(3599..3600)-, cdbSNP:34903148
complement(3602)-t, cdbSNP:139287784
complement(3636)-g, cdbSNP:142047326
complement(3646)-t, gdbSNP:138798067
complement(3656)-g, cdbSNP:371498017
complement(3667)-t, adbSNP:145004243
complement(3673)-g, adbSNP:141412644
complement(3688)-g, adbSNP:138344471
3689+a, gdbSNP:200842643
complement(3706)-g, cdbSNP:199991212
complement(3722)-g, adbSNP:200924744
complement(3728)-t, cdbSNP:150453226
complement(3736)-g, adbSNP:58735123
complement(3745)-g, adbSNP:201359490
complement(3763)-g, adbSNP:140529288
complement(3768)-c, adbSNP:201906383
complement(3788)-g, adbSNP:373091194
complement(3789)-t, cdbSNP:76488917
complement(3805)-g, adbSNP:144273492
complement(3806)-t, cdbSNP:199994766
complement(3812)-t, cdbSNP:369435228
complement(3816)-g, adbSNP:200742809
complement(3817)-t, cdbSNP:142079276
complement(3851)-g, cdbSNP:147558074
complement(3862)-g, adbSNP:373231418
complement(3864)-t, c, adbSNP:145055283
complement(3872)-t, cdbSNP:368657696
complement(3882)-g, cdbSNP:375839558
complement(3907)-g, cdbSNP:199719959
complement(3934)-g, adbSNP:200708159
3935+a, gdbSNP:201618094
complement(3942)-g, adbSNP:183029626
3943+a, g, tdbSNP:200057338
complement(3946)-g, adbSNP:190489079
complement(3948)-t, cdbSNP:367891675
complement(3972)-t, cdbSNP:374238222
3992+c, tdbSNP:714181
complement(3994)-g, adbSNP:201582780
complement(3995)-t, gdbSNP:144647122
complement(4001)-t, cdbSNP:186784513
complement(4029)-g, cdbSNP:149748089
4047+a, gdbSNP:201446870
complement(4065)-t, g, adbSNP:78541095
complement(4108)-g, adbSNP:371122297
complement(4127)-t, cdbSNP:75685199
complement(4134)-t, cdbSNP:183926603
complement(4205)-g, adbSNP:368695839
4210..4212+, attdbSNP:199897550
complement(4210)-t, cdbSNP:370761463
complement(4215)-g, adbSNP:112016711
complement(4258)-t, cdbSNP:202032197
complement(4269)-t, cdbSNP:112748917
complement(4275)-c, adbSNP:139544666
complement(4289)-g, adbSNP:3827530
complement(4295)-g, adbSNP:376133540
complement(4296)-t, cdbSNP:200407926
complement(4303)-g, adbSNP:142008398
complement(4307)-t, cdbSNP:192144067
complement(4328)-g, adbSNP:186036075
complement(4365)-g, adbSNP:376232540
complement(4370)-g, adbSNP:201294529
complement(4373)-t, cdbSNP:372991604
complement(4385)-g, adbSNP:202148391
complement(4389)-t, cdbSNP:3810814
complement(4397)-c, adbSNP:201037631
complement(4401)-g, adbSNP:146054214
complement(4402)-t, cdbSNP:370663234
complement(4408)-g, adbSNP:141860134
complement(4409)-g, adbSNP:374056556
complement(4410)-t, cdbSNP:77699867
complement(4426)-g, adbSNP:201422743
complement(4429)-t, cdbSNP:199958007
complement(4434)-g, adbSNP:367741978
complement(4439)-g, adbSNP:3810813
complement(4458)-g, adbSNP:376276225
complement(4475)-g, adbSNP:140103960
4476+c, gdbSNP:200928592
complement(4477)-t, cdbSNP:373107728
complement(4484)-g, adbSNP:149011965
complement(4495)-t, gdbSNP:112596894
complement(4508)-t, g, adbSNP:188808130
complement(4513)-t, cdbSNP:374481298
complement(4520)-t, cdbSNP:377243383
complement(4538)-c, adbSNP:146837290
complement(4539)-g, adbSNP:140254478
complement(4560)-g, cdbSNP:374311917
complement(4561)-t, cdbSNP:200008765
complement(4566)-g, cdbSNP:369714443
complement(4567)-t, gdbSNP:142040192
complement(4577)-g, adbSNP:375172024
complement(4578)-t, cdbSNP:147600630
complement(4590)-t, cdbSNP:116781836
complement(4604)-g, adbSNP:371394594
complement(4629)-g, adbSNP:201826765
complement(4630)-t, cdbSNP:367562934
complement(4651)-t, cdbSNP:140051968
complement(4660)-g, adbSNP:200310925
complement(4668)-g, adbSNP:112022398
complement(4673)-g, cdbSNP:151144102
complement(4682)-g, adbSNP:144720266
complement(4684)-t, gdbSNP:142205392
complement(4686)-g, adbSNP:148695476
complement(4695)-t, cdbSNP:115491049
complement(4723)-g, adbSNP:368434737
complement(4724)-t, cdbSNP:375108717
complement(4726)-t, cdbSNP:17136464
complement(4741)-g, adbSNP:369846826
complement(4742)-t, cdbSNP:79174372
complement(4760)-g, adbSNP:371580654
complement(4813)-t, cdbSNP:376437029
complement(4824)-g, adbSNP:146079010
complement(4825)-t, cdbSNP:376112909
complement(4857)-g, cdbSNP:138125792
complement(4868)-g, adbSNP:140892471
complement(4888)-t, adbSNP:141567438
complement(4953)-, gdbSNP:35603561
complement(4962)-g, cdbSNP:139377113
complement(4965)-g, adbSNP:77718962
complement(4966)-t, cdbSNP:371090786
complement(4971)-g, adbSNP:368388100
complement(4974)-t, cdbSNP:373300793
complement(5008)-t, cdbSNP:144037266
complement(5011)-c, adbSNP:138484365
complement(5036)-g, adbSNP:72778139
complement(5043)-g, adbSNP:374692299
complement(5054)-g, cdbSNP:372321470
complement(5072)-t, cdbSNP:148856258
complement(5076)-g, adbSNP:145444328
complement(5083)-t, gdbSNP:200536796
complement(5106)-t, cdbSNP:150097733
complement(5112)-g, cdbSNP:140872903
complement(5121)-t, cdbSNP:146532299
complement(5127)-g, adbSNP:3810812
complement(5135)-g, adbSNP:370637700
complement(5150)-g, adbSNP:112694849
complement(5157)-c, adbSNP:139254595
complement(5166)-g, adbSNP:146731362
complement(5172)-g, adbSNP:142851654
5190+c, tdbSNP:200225783
complement(5194)-g, cdbSNP:148542931
complement(5196)-c, adbSNP:377443183
complement(5199)-g, adbSNP:144666372
complement(5201)-g, adbSNP:267604539
complement(5203)-g, adbSNP:111866205
complement(5207)-g, adbSNP:149362820
complement(5208)-t, cdbSNP:78635099
complement(5217)-t, cdbSNP:147315419
5224+g, tdbSNP:200377191
complement(5227)-t, cdbSNP:78770603
complement(5275)-dbSNP:
complement(5275)-g, adbSNP:77021998
complement(5276)-t, cdbSNP:369852048
complement(5285)-t, adbSNP:150460384
complement(5310)-t, cdbSNP:141196682
complement(5324)-t, cdbSNP:145145731
complement(5330)-g, adbSNP:377185661
complement(5342)-g, adbSNP:182432298
complement(5343)-t, cdbSNP:372472816
complement(5378)-dbSNP:
complement(5378)-t, cdbSNP:199969428
complement(5392)-g, adbSNP:181782315
complement(5395)-g, cdbSNP:148228302
complement(5425)-g, cdbSNP:143026968
complement(5450)-g, cdbSNP:200628199
complement(5456)-g, adbSNP:201841711
complement(5457)-g, adbSNP:370775954
complement(5460)-t, cdbSNP:377081199
complement(5463)-g, adbSNP:140844106
complement(5481..5482)-, gdbSNP:36003440
complement(5484)-t, cdbSNP:146423772
5492+a, gdbSNP:201504997
complement(5495)-g, adbSNP:200178217
complement(5496)-t, cdbSNP:372206872
complement(5500)-g, adbSNP:145527531
complement(5509)-t, adbSNP:201688321
complement(5510)-g, adbSNP:199573277
complement(5530)-t, cdbSNP:140417509
complement(5543)-g, cdbSNP:200899425
complement(5545)-g, cdbSNP:368102037
complement(5554)-c, adbSNP:145557355
complement(5577)-t, cdbSNP:199604116
complement(5591)-t, cdbSNP:149726415
complement(5599)-t, cdbSNP:200507644
complement(5621)-t, gdbSNP:376024875
complement(5627)-t, cdbSNP:139304111
complement(5654)-g, adbSNP:377544881
complement(5656)-g, adbSNP:7196345
5667+c, gdbSNP:199592185
complement(5703)-g, adbSNP:367566849
complement(5723)-g, adbSNP:184699331
complement(5724)-g, adbSNP:202099433
complement(5773)-t, adbSNP:75182789
5782+dbSNP:
5782+a, tdbSNP:200074692
complement(5805)-t, cdbSNP:140666540
complement(5807)-g, adbSNP:147251446
5810+g, tdbSNP:200991968
complement(5815)-g, adbSNP:199838670
complement(5816)-g, cdbSNP:376960842
complement(5841)-t, cdbSNP:369714623
complement(5844)-c, adbSNP:61031231
complement(5850)-c, adbSNP:200262630
complement(5855)-g, adbSNP:144057906
complement(5856)-g, cdbSNP:140231739
complement(5866)-t, cdbSNP:201214017
complement(5873)-g, adbSNP:377329498
complement(5877)-t, cdbSNP:370495748
complement(5886)-g, adbSNP:144776083
complement(5891)-g, adbSNP:372921011
complement(5895)-t, cdbSNP:138445982
complement(5905)-t, cdbSNP:377648201
complement(5908)-g, adbSNP:143818824
complement(5920)-t, cdbSNP:369180077
complement(5992)-t, cdbSNP:374876624
complement(5998)-g, adbSNP:371875095
complement(6009)-t, cdbSNP:368848191
complement(6015)-g, cdbSNP:201687045
complement(6050)-c, adbSNP:371390105
complement(6060)-g, adbSNP:142477564
complement(6063)-g, adbSNP:200473811
complement(6068)-t, cdbSNP:201036767
complement(6071)-c, adbSNP:375885941
complement(6072)-t, cdbSNP:199998573
complement(6095)-t, cdbSNP:372767321
complement(6103)-g, adbSNP:199736788
complement(6104)-t, cdbSNP:373558741
complement(6124)-g, adbSNP:375100050
complement(6128)-t, cdbSNP:111738042
complement(6140)-t, cdbSNP:3751839
complement(6154)-g, adbSNP:375806847
complement(6172)-, gdbSNP:3833838
complement(6245)-g, adbSNP:76661336
complement(6291)-t, cdbSNP:117801349
complement(6326)-t, cdbSNP:192746359
complement(6384)-g, adbSNP:73505410
complement(6500)-t, cdbSNP:183576223
complement(6501)-g, cdbSNP:78541056
complement(6506)-g, adbSNP:369843531
complement(6665)-g, adbSNP:193089761
complement(6666)-t, cdbSNP:115773986
complement(6687)-g, adbSNP:146163310
complement(6706)-t, cdbSNP:114600718
complement(6755)-, tdbSNP:374613336
complement(6787)-t, cdbSNP:116003727
complement(6836)-t, cdbSNP:188068873
complement(6853)-g, adbSNP:75146816
complement(6899)-t, cdbSNP:113274749
complement(6939)-t, cdbSNP:115690937
complement(6943)-g, cdbSNP:371879504
complement(7116)-g, adbSNP:57699393
complement(7136)-t, cdbSNP:75773027
complement(7144)-g, cdbSNP:374659314
complement(7154)-t, cdbSNP:78346491
complement(7159)-g, adbSNP:183371548
complement(7167)-t, cdbSNP:149634682
complement(7173)-t, cdbSNP:117958592
complement(7224)-g, adbSNP:71388524
complement(7227)-t, cdbSNP:116498263
Gene SymbolSLX4
Gene SynonymBTBD12; FANCP; MUS312
Chromosome16
Locus Map16p13.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_032444 Homo sapiens SLX4 structure-specific endonuclease subunit (SLX4), mRNA. On-demand $2699.00 30
Title Premature activation of the SLX4 complex by Vpr promotes G2/M arrest and escape from innate immune sensing .
Author Laguette N, Bregnard C, Hue P, Basbous J, Yatim A, Larroque M, Kirchhoff F, Constantinou A, Sobhian B and Benkirane M.
Journal Cell 156 (1-2), 134-145 (2014)
Title Coordinated actions of SLX1-SLX4 and MUS81-EME1 for Holliday junction resolution in human cells .
Author Wyatt HD, Sarbajna S, Matos J and West SC.
Journal Mol. Cell 52 (2), 234-247 (2013)
Title Low prevalence of SLX4 loss-of-function mutations in non-BRCA1/2 breast and/or ovarian cancer families .
Author de Garibay GR, Diaz A, Gavina B, Romero A, Garre P, Vega A, Blanco A, Tosar A, Diez O, Perez-Segura P, Diaz-Rubio E, Caldes T and de la Hoya M.
Journal Eur. J. Hum. Genet. 21 (8), 883-886 (2013)
Title Regulation of multiple DNA repair pathways by the Fanconi anemia protein SLX4 .
Author Kim Y, Spitz GS, Veturi U, Lach FP, Auerbach AD and Smogorzewska A.
Journal Blood 121 (1), 54-63 (2013)
Title Analysis of the novel fanconi anemia gene SLX4/FANCP in familial breast cancer cases .
Author Bakker JL, van Mil SE, Crossan G, Sabbaghian N, De Leeneer K, Poppe B, Adank M, Gille H, Verheul H, Meijers-Heijboer H, de Winter JP, Claes K, Tischkowitz M and Waisfisz Q.
Journal Hum. Mutat. 34 (1), 70-73 (2013)
Title Mammalian BTBD12/SLX4 assembles a Holliday junction resolvase and is required for DNA repair .
Author Svendsen JM, Smogorzewska A, Sowa ME, O'Connell BC, Gygi SP, Elledge SJ and Harper JW.
Journal Cell 138 (1), 63-77 (2009)
Title Drosophila MUS312 and the vertebrate ortholog BTBD12 interact with .
Author Andersen SL, Bergstralh DT, Kohl KP, LaRocque JR, Moore CB and Sekelsky J.
Journal Mol. Cell 35 (1), 128-135 (2009)
Title Coordination of structure-specific nucleases by human SLX4/BTBD12 is required for DNA repair .
Author Munoz IM, Hain K, Declais AC, Gardiner M, Toh GW, Sanchez-Pulido L, Heuckmann JM, Toth R, Macartney T, Eppink B, Kanaar R, Ponting CP, Lilley DM and Rouse J.
Journal Mol. Cell 35 (1), 116-127 (2009)
Title The sequence and analysis of duplication-rich human chromosome 16 .
Author Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM and Pennacchio LA.
Journal Nature 432 (7020), 988-994 (2004)
Title Fanconi Anemia .
Author Alter,B.P. and Kupfer,G.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.