• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens SLX4 structure-specific endonuclease subunit homolog (S. cerevisiae) (SLX4), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_032444 Homo sapiens SLX4 structure-specific endonuclease subunit homolog (S. cerevisiae) (SLX4), mRNA. GenEZ ORF Cloning On-demand $2699.00 30

*Business Day

Related Services

RefSeq Version NM_032444.2, 63252862
Length 7304 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens SLX4 structure-specific endonuclease subunit homolog (S. cerevisiae) (SLX4), mRNA.
Product structure-specific endonuclease subunit SLX4
Comment

Summary: This gene encodes a structure-specific endonuclease subunit. The encoded protein contains a central BTB domain and it forms a multiprotein complex with the ERCC4(XPF)-ERCC1, MUS81-EME1, and SLX1 endonucleases, and also associates with MSH2/MSH3 mismatch repair complex, telomere binding complex TERF2(TRF2)-TERF2IP(RAP1), the protein kinase PLK1 and the uncharacterized protein C20orf94. The multiprotein complex is required for repair of specific types of DNA lesions and is critical for cellular responses to replication fork failure. The encoded protein acts as a docking platform for the assembly of multiple structure-specific endonucleases.[provided by RefSeq, Jan 2011].

RefSeq NP_115820.2
CDS 628..6132
Misc Feature(1)613..615
Misc Feature(2)628..2634
Misc Feature(3)628..2634
Misc Feature(4)1486..1488
Misc Feature(5)2668..2991
Misc Feature(6)2677..6129
Misc Feature(7)3757..3759
Misc Feature(8)4609..5571
Misc Feature(9)5032..5034
Misc Feature(10)5521..6129
Exon (1)1..25
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (2)26..1162
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (3)1163..1387
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (4)1388..1577
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (5)1578..1790
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (6)1791..1993
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (7)1994..2310
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (8)2311..2551
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (9)2552..2640
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (10)2641..2787
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (11)2788..2954
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (12)2955..5263
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (13)5264..5366
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (14)5367..5780
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Exon (15)5781..7293
Gene:SLX4
Gene Synonym:BTBD12; FANCP; MUS312
Translation MKLSVNEAQLGFYLGSLSHLSACPGIDPRSSEDQPESLKTGQMMDESDEDFKELCASFFQ RVKKHGIKEVSGERKTQKAASNGTQIRSKLKRTKQTATKTKTLQGPAEKKPPSGSQAPRT KKQRVTKWQASEPAHSVNGEGGVLASAPDPPVLRETAQNTQTGNQQEPSPNLSREKTREN VPNSDSQPPPSCLTTAVPSPSKPRTAQLVLQRMQQFKRADPERLRHASEECSLEAAREEN VPKDPQEEMMAGNVYGLGPPAPESDAAVALTLQQEFARVGASAHDDSLEEKGLFFCQICQ KNLSAMNVTRREQHVNRCLDEAEKTLRPSVPQIPECPICGKPFLTLKSRTSHLKQCAVKM EVGPQLLLQAVRLQTAQPEGSSSPPMFSFSDHSRGLKRRGPTSKKEPRKRRKVDEAPSED LLVAMALSRSEMEPGAAVPALRLESAFSERIRPEAENKSRKKKPPVSPPLLLVQDSETTG RQIEDRVALLLSEEVELSSTPPLPASRILKEGWERAGQCPPPPERKQSFLWEGSALTGAW AMEDFYTARLVPPLVPQRPAQGLMQEPVPPLVPPEHSELSERRSPALHGTPTAGCGSRGP SPSASQREHQALQDLVDLAREGLSASPWPGSGGLAGSEGTAGLDVVPGGLPLTGFVVPSQ DKHPDRGGRTLLSLGLLVADFGAMVNNPHLSDVQFQTDSGEVLYAHKFVLYARCPLLIQY VNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVS ELVHLCEQVPIATDSEGKPWEEKEAENCESRAENFQELLRSMWADEEEEAETLLKSKDHE EDQENVNEAEMEEIYEFAATQRKLLQEERAAGAGEDADWLEGGSPVSGQLLAGVQVQKQW DKVEEMEPLEPGRDEAATTWEKMGQCALPPPQGQHSGARGAEAPEQEAPEEALGHSSCSS PSRDCQAERKEGSLPHSDDAGDYEQLFSSTQGEISEPSQITSEPEEQSGAVRERGLEVSH RLAPWQASPPHPCRFLLGPPQGGSPRGSHHTSGSSLSTPRSRGGTSQVGSPTLLSPAVPS KQKRDRSILTLSKEPGHQKGKERRSVLECRNKGVLMFPEKSPSIDLTQSNPDHSSSRSQK SSSKLNEEDEVILLLDSDEELELEQTKMKSISSDPLEEKKALEISPRSCELFSIIDVDAD QEPSQSPPRSEAVLQQEDEGALPENRGSLGRRGAPWLFCDRESSPSEASTTDTSWLVPAT PLASRSRDCSSQTQISSLRSGLAVQAVTQHTPRASVGNREGNEVAQKFSVIRPQTPPPQT PSSCLTPVSPGTSDGRRQGHRSPSRPHPGGHPHSSPLAPHPISGDRAHFSRRFLKHSPPG PSFLNQTPAGEVVEVGDSDDEQEVASHQANRSPPLDSDPPIPIDDCCWHMEPLSPIPIDH WNLERTGPLSTSSPSRRMNEAADSRDCRSPGLLDTTPIRGSCTTQRKLQEKSSGAGSLGN SRPSFLNSALWDVWDGEEQRPPETPPPAQMPSAGGAQKPEGLETPKGANRKKNLPPKVPI TPMPQYSIMETPVLKKELDRFGVRPLPKRQMVLKLKEIFQYTHQTLDSDSEDESQSSQPL LQAPHCQTLASQTYKPSRAGVHAQQEATTGPGAHRPKGPAKTKGPRHQRKHHESITPPSR SPTKEAPPGLNDDAQIPASQESVATSVDGSDSSLSSQSSSSCEFGAAFESAGEEEGEGEV SASQAAVQAADTDEALRCYIRSKPALYQKVLLYQPFELRELQAELRQNGLRVSSRRLLDF LDTHCITFTTAATRREKLQGRRRQPRGKKKVERN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(269)-dbSNP:
complement(269)-g, cdbSNP:57910835
complement(333)-t, cdbSNP:59311338
complement(357)-t, cdbSNP:149773885
complement(419..420)-, gdbSNP:149138178
complement(433)-, tdbSNP:146273887
complement(524)-t, cdbSNP:73505426
complement(553)-t, cdbSNP:182545721
complement(582)-t, cdbSNP:113023461
complement(607)-g, cdbSNP:200717103
complement(609)-t, cdbSNP:113845637
complement(685)-g, adbSNP:146667545
complement(687)-g, adbSNP:200430973
complement(700)-t, cdbSNP:201533738
complement(712)-g, adbSNP:144832924
complement(713)-t, cdbSNP:149117119
complement(717)-g, adbSNP:118089506
complement(738)-t, gdbSNP:188729744
complement(739)-g, adbSNP:141167501
complement(762)-g, adbSNP:146582790
complement(772)-t, cdbSNP:139757085
complement(792)-g, adbSNP:202030834
complement(815)-t, cdbSNP:147706467
complement(816)-t, gdbSNP:28612736
complement(820)-g, adbSNP:145345695
complement(844)-g, cdbSNP:139829211
complement(857)-t, cdbSNP:147458405
complement(858)-t, cdbSNP:143279888
complement(871)-g, adbSNP:202237877
complement(874)-g, adbSNP:200319106
complement(885)-t, cdbSNP:112205823
complement(926)-c, adbSNP:201163062
complement(963)-t, cdbSNP:79126454
complement(966)-g, adbSNP:144326379
complement(993)-t, cdbSNP:149626570
complement(998)-g, cdbSNP:200113605
complement(1048)-c, adbSNP:137976282
complement(1049)-c, adbSNP:77306735
complement(1050)-c, adbSNP:111405249
complement(1079)-t, cdbSNP:200191906
complement(1087)-g, adbSNP:141639275
complement(1092)-t, cdbSNP:138512851
complement(1094)-t, gdbSNP:144614070
complement(1112)-g, adbSNP:140876043
complement(1116)-c, adbSNP:201211891
complement(1126)-t, cdbSNP:151018140
complement(1180)-dbSNP:
complement(1180)-g, adbSNP:201769293
complement(1182)-g, adbSNP:74640850
complement(1206)-t, cdbSNP:148887586
complement(1217)-g, adbSNP:147826749
complement(1237)-g, adbSNP:79842542
complement(1253)-g, adbSNP:201985764
complement(1305)-g, adbSNP:28516461
complement(1306)-t, cdbSNP:147872182
complement(1323)-t, gdbSNP:147387334
complement(1327)-t, cdbSNP:149779179
complement(1329)-g, cdbSNP:201161027
complement(1334)-t, cdbSNP:200803578
complement(1336)-g, adbSNP:199912910
complement(1337)-t, cdbSNP:138615800
complement(1339)-t, cdbSNP:150703293
complement(1345)-t, cdbSNP:114744903
complement(1361)-t, cdbSNP:199929086
complement(1369)-t, cdbSNP:148547201
complement(1379)-g, adbSNP:201117707
complement(1380)-t, cdbSNP:8061528
complement(1419)-dbSNP:
complement(1419)-g, adbSNP:201383482
complement(1459)-g, adbSNP:141597706
complement(1460)-g, adbSNP:201192909
complement(1472)-g, adbSNP:138618354
complement(1600)-dbSNP:
complement(1600)-t, adbSNP:181942292
complement(1626)-g, adbSNP:7198338
complement(1637)-g, adbSNP:200363140
complement(1692)-g, adbSNP:200183071
complement(1704)-c, adbSNP:149470704
complement(1736)-g, adbSNP:189224493
complement(1779)-t, cdbSNP:112511042
complement(1780)-t, gdbSNP:115694169
complement(1783)-t, cdbSNP:113490934
complement(1789)-t, adbSNP:199774640
complement(1805)-dbSNP:
complement(1805)-t, cdbSNP:112301713
complement(1816)-t, cdbSNP:202204661
complement(1819)-g, adbSNP:138799572
complement(1820)-t, cdbSNP:200030312
complement(1859)-t, cdbSNP:201009985
complement(1870)-t, cdbSNP:146021821
complement(1911..1912)-, gdbSNP:35570194
complement(1913)-t, cdbSNP:141625470
complement(1917)-t, cdbSNP:201430172
complement(1935)-t, cdbSNP:147915773
complement(1940)-c, adbSNP:74553110
complement(1998)-dbSNP:
complement(1998)-c, adbSNP:74319927
complement(1999)-t, cdbSNP:149126845
complement(2012)-t, cdbSNP:112133511
complement(2049)-t, cdbSNP:181470615
complement(2069)-t, cdbSNP:145194745
complement(2082)-t, gdbSNP:150053867
complement(2097)-g, adbSNP:139766312
complement(2117)-g, adbSNP:200337039
complement(2174)-g, adbSNP:199683722
complement(2190)-g, adbSNP:146360238
complement(2200)-t, gdbSNP:143831403
complement(2211)-g, cdbSNP:139865448
complement(2224)-g, cdbSNP:200437227
complement(2229)-g, adbSNP:201754095
complement(2264)-t, cdbSNP:150547487
complement(2268)-g, adbSNP:200497436
complement(2334)-dbSNP:
complement(2334)-t, cdbSNP:141687678
complement(2367)-g, adbSNP:200354014
complement(2368)-t, cdbSNP:200949593
complement(2382)-t, g, adbSNP:114016359
complement(2391)-g, adbSNP:201638593
complement(2413)-t, cdbSNP:144454312
complement(2429)-g, adbSNP:59706816
complement(2430)-t, cdbSNP:144892556
complement(2459)-c, adbSNP:201641321
complement(2472)-c, adbSNP:1056084
complement(2473)-g, adbSNP:199863797
complement(2500)-t, cdbSNP:200755122
complement(2523)-g, cdbSNP:200859735
complement(2525)-g, adbSNP:1056085
complement(2537)-g, adbSNP:200475686
complement(2538)-g, adbSNP:200013924
complement(2571)-dbSNP:
complement(2571)-g, adbSNP:149315267
complement(2633)-g, adbSNP:200807331
complement(2639)-g, adbSNP:77985244
complement(2649)-dbSNP:
complement(2649)-g, c, adbSNP:139900828
complement(2653)-g, adbSNP:199711185
complement(2661)-c, adbSNP:200278096
complement(2674)-t, cdbSNP:115866745
complement(2692)-g, adbSNP:138124860
complement(2706)-g, adbSNP:150206155
complement(2730)-g, cdbSNP:73505420
complement(2752)-t, cdbSNP:151026877
complement(2771)-g, adbSNP:143674221
complement(2821)-dbSNP:
complement(2821)-c, adbSNP:202189103
complement(2836)-g, cdbSNP:140706384
complement(2837)-t, cdbSNP:146901714
complement(2838)-g, adbSNP:113436106
complement(2855)-g, adbSNP:1061002
complement(2862)-g, adbSNP:75184268
complement(2868)-g, adbSNP:143790956
complement(2873)-t, cdbSNP:140109914
complement(2876)-g, adbSNP:145353518
complement(2897)-g, adbSNP:149897636
complement(2917)-g, cdbSNP:151105762
complement(2932)-g, cdbSNP:150712805
complement(2943..2944)-, gdbSNP:34644639
complement(2959)-dbSNP:
complement(2959)-g, cdbSNP:142722925
complement(2986)-t, cdbSNP:140600202
complement(3008)-t, adbSNP:201622632
complement(3015)-t, cdbSNP:113965715
complement(3018)-g, adbSNP:147208178
complement(3076)-g, cdbSNP:143730668
complement(3084)-t, cdbSNP:148026020
complement(3111)-g, cdbSNP:199656607
complement(3211)-g, adbSNP:200715208
complement(3212)-t, cdbSNP:143558209
complement(3224)-c, adbSNP:201539019
complement(3236)-g, adbSNP:149584080
complement(3239)-g, adbSNP:138259798
complement(3247)-t, cdbSNP:113420526
complement(3248)-t, cdbSNP:150402424
complement(3255)-g, adbSNP:201279467
complement(3275)-t, cdbSNP:112994550
complement(3281)-g, adbSNP:147492092
complement(3294)-t, cdbSNP:146790631
complement(3308)-c, adbSNP:145137472
complement(3348)-c, adbSNP:141450907
complement(3357)-t, cdbSNP:151080921
complement(3373)-c, adbSNP:79448721
complement(3376)-t, cdbSNP:148428054
complement(3383)-g, adbSNP:145533919
complement(3403)-g, adbSNP:201703364
complement(3413)-g, adbSNP:117707719
complement(3451)-g, cdbSNP:114014006
complement(3481)-t, cdbSNP:59939128
complement(3482)-g, adbSNP:78637028
complement(3491)-t, cdbSNP:143694260
complement(3504)-g, adbSNP:139217437
complement(3513)-g, adbSNP:202053414
complement(3516)-t, cdbSNP:201978747
complement(3551)-g, adbSNP:114472821
complement(3554)-t, gdbSNP:141294497
complement(3585)-g, cdbSNP:148111699
complement(3601..3602)-, cdbSNP:34903148
complement(3602)-t, cdbSNP:139287784
complement(3636)-g, cdbSNP:142047326
complement(3646)-t, gdbSNP:138798067
complement(3667)-t, adbSNP:145004243
complement(3673)-g, adbSNP:141412644
complement(3688)-g, adbSNP:138344471
complement(3689)-g, adbSNP:200842643
complement(3706)-g, cdbSNP:199991212
complement(3722)-g, adbSNP:200924744
complement(3728)-t, cdbSNP:150453226
complement(3736)-g, adbSNP:58735123
complement(3745)-g, adbSNP:201359490
complement(3763)-g, adbSNP:140529288
complement(3768)-c, adbSNP:201906383
complement(3789)-t, cdbSNP:76488917
complement(3805)-g, adbSNP:144273492
complement(3806)-t, cdbSNP:199994766
complement(3816)-g, adbSNP:200742809
complement(3817)-t, cdbSNP:142079276
complement(3851)-g, cdbSNP:147558074
complement(3864)-t, cdbSNP:145055283
complement(3907)-g, cdbSNP:199719959
complement(3934)-g, adbSNP:200708159
complement(3935)-g, adbSNP:201618094
complement(3942)-g, adbSNP:183029626
complement(3943)-g, adbSNP:200057338
complement(3946)-g, adbSNP:190489079
complement(3992)-t, cdbSNP:714181
complement(3994)-g, adbSNP:201582780
complement(3995)-t, gdbSNP:144647122
complement(4001)-t, cdbSNP:186784513
complement(4029)-g, cdbSNP:149748089
complement(4047)-g, adbSNP:201446870
complement(4065)-t, g, adbSNP:78541095
complement(4127)-t, cdbSNP:75685199
complement(4134)-t, cdbSNP:183926603
complement(4210..4212)-, attdbSNP:199897550
complement(4215)-g, adbSNP:112016711
complement(4258)-t, cdbSNP:202032197
complement(4269)-t, cdbSNP:112748917
complement(4275)-c, adbSNP:139544666
complement(4289)-g, adbSNP:3827530
complement(4296)-t, cdbSNP:200407926
complement(4303)-g, adbSNP:142008398
complement(4307)-t, cdbSNP:192144067
complement(4328)-g, adbSNP:186036075
complement(4370)-g, adbSNP:201294529
complement(4385)-g, adbSNP:202148391
complement(4389)-t, cdbSNP:3810814
complement(4397)-c, adbSNP:201037631
complement(4401)-g, adbSNP:146054214
complement(4408)-g, adbSNP:141860134
complement(4410)-t, cdbSNP:77699867
complement(4426)-g, adbSNP:201422743
complement(4429)-t, cdbSNP:199958007
complement(4439)-g, adbSNP:3810813
complement(4475)-g, adbSNP:140103960
complement(4476)-g, cdbSNP:200928592
complement(4484)-g, adbSNP:149011965
complement(4495)-t, gdbSNP:112596894
complement(4508)-t, gdbSNP:188808130
complement(4538)-c, adbSNP:146837290
complement(4539)-g, adbSNP:140254478
complement(4561)-t, cdbSNP:200008765
complement(4567)-t, gdbSNP:142040192
complement(4578)-t, cdbSNP:147600630
complement(4590)-t, cdbSNP:116781836
complement(4629)-g, adbSNP:201826765
complement(4651)-t, cdbSNP:140051968
complement(4660)-g, adbSNP:200310925
complement(4668)-g, adbSNP:112022398
complement(4673)-g, cdbSNP:151144102
complement(4682)-g, adbSNP:144720266
complement(4684)-t, gdbSNP:142205392
complement(4686)-g, adbSNP:148695476
complement(4695)-t, cdbSNP:115491049
complement(4726)-t, cdbSNP:17136464
complement(4742)-t, cdbSNP:79174372
complement(4824)-g, adbSNP:146079010
complement(4853)-t, gdbSNP:149588819
complement(4857)-g, cdbSNP:138125792
complement(4868)-g, adbSNP:140892471
complement(4888)-t, adbSNP:141567438
complement(4954)-, gdbSNP:35603561
complement(4962)-g, cdbSNP:139377113
complement(4965)-g, adbSNP:77718962
complement(5008)-t, cdbSNP:144037266
complement(5011)-c, adbSNP:138484365
complement(5036)-g, adbSNP:72778139
complement(5072)-t, cdbSNP:148856258
complement(5076)-g, adbSNP:145444328
complement(5083)-t, gdbSNP:200536796
complement(5106)-t, cdbSNP:150097733
complement(5112)-g, cdbSNP:140872903
complement(5121)-t, cdbSNP:146532299
complement(5127)-g, adbSNP:3810812
complement(5150)-g, adbSNP:112694849
complement(5157)-c, adbSNP:139254595
complement(5166)-g, adbSNP:146731362
complement(5172)-g, adbSNP:142851654
complement(5190)-t, cdbSNP:200225783
complement(5194)-g, cdbSNP:148542931
complement(5199)-g, adbSNP:144666372
complement(5203)-g, adbSNP:111866205
complement(5207)-g, adbSNP:149362820
complement(5208)-t, cdbSNP:78635099
complement(5217)-t, cdbSNP:147315419
complement(5224)-t, gdbSNP:200377191
complement(5227)-t, cdbSNP:78770603
complement(5275)-dbSNP:
complement(5275)-g, adbSNP:77021998
complement(5285)-t, adbSNP:150460384
complement(5310)-t, cdbSNP:141196682
complement(5324)-t, cdbSNP:145145731
complement(5342)-g, adbSNP:182432298
complement(5378)-dbSNP:
complement(5378)-t, cdbSNP:199969428
complement(5392)-g, adbSNP:181782315
complement(5395)-g, cdbSNP:148228302
complement(5425)-g, cdbSNP:143026968
complement(5450)-g, cdbSNP:200628199
complement(5456)-g, adbSNP:201841711
complement(5463)-g, adbSNP:140844106
complement(5482..5483)-, gdbSNP:36003440
complement(5484)-t, cdbSNP:146423772
complement(5492)-g, adbSNP:201504997
complement(5495)-g, adbSNP:200178217
complement(5500)-g, adbSNP:145527531
complement(5509)-t, adbSNP:201688321
complement(5510)-g, adbSNP:199573277
complement(5530)-t, cdbSNP:140417509
complement(5543)-g, cdbSNP:200899425
complement(5554)-c, adbSNP:145557355
complement(5577)-t, cdbSNP:199604116
complement(5591)-t, cdbSNP:149726415
complement(5599)-t, cdbSNP:200507644
complement(5627)-t, cdbSNP:139304111
complement(5656)-g, adbSNP:7196345
complement(5667)-g, cdbSNP:199592185
complement(5723)-g, adbSNP:184699331
complement(5724)-g, adbSNP:202099433
complement(5773)-t, adbSNP:75182789
complement(5782)-dbSNP:
complement(5782)-t, adbSNP:200074692
complement(5805)-t, cdbSNP:140666540
complement(5807)-g, adbSNP:147251446
complement(5810)-t, gdbSNP:200991968
complement(5815)-g, adbSNP:199838670
complement(5844)-c, adbSNP:61031231
complement(5850)-c, adbSNP:200262630
complement(5855)-g, adbSNP:144057906
complement(5856)-g, cdbSNP:140231739
complement(5866)-t, cdbSNP:201214017
complement(5886)-g, adbSNP:144776083
complement(5890)-c, adbSNP:149417177
complement(5895)-t, cdbSNP:138445982
complement(5908)-g, adbSNP:143818824
complement(6015)-g, cdbSNP:201687045
complement(6060)-g, adbSNP:142477564
complement(6063)-g, adbSNP:200473811
complement(6068)-t, cdbSNP:201036767
complement(6072)-t, cdbSNP:199998573
complement(6103)-g, adbSNP:199736788
complement(6128)-t, cdbSNP:111738042
complement(6140)-t, cdbSNP:3751839
complement(6176)-, gdbSNP:3833838
complement(6245)-g, adbSNP:76661336
complement(6291)-t, cdbSNP:117801349
complement(6326)-t, cdbSNP:192746359
complement(6384)-g, adbSNP:73505410
complement(6500)-t, cdbSNP:183576223
complement(6501)-g, cdbSNP:78541056
complement(6665)-g, adbSNP:193089761
complement(6666)-t, cdbSNP:115773986
complement(6687)-g, adbSNP:146163310
complement(6706)-t, cdbSNP:114600718
complement(6787)-t, cdbSNP:116003727
complement(6836)-t, cdbSNP:188068873
complement(6853)-g, adbSNP:75146816
complement(6899)-t, cdbSNP:113274749
complement(6939)-t, cdbSNP:115690937
complement(7116)-g, adbSNP:57699393
complement(7136)-t, cdbSNP:75773027
complement(7154)-t, cdbSNP:78346491
complement(7159)-g, adbSNP:183371548
complement(7167)-t, cdbSNP:149634682
complement(7173)-t, cdbSNP:117958592
complement(7224)-g, adbSNP:71388524
complement(7227)-t, cdbSNP:116498263
Gene SymbolSLX4
Gene SynonymBTBD12; FANCP; MUS312
Chromosome16
Locus Map16p13.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_032444 Homo sapiens SLX4 structure-specific endonuclease subunit homolog (S. cerevisiae) (SLX4), mRNA. On-demand $2699.00 30
Title Regulation of multiple DNA repair pathways by the Fanconi anemia protein SLX4 .
Author Kim,Y., Spitz,G.S., Veturi,U., Lach,F.P., Auerbach,A.D. and Smogorzewska,A.
Journal Blood 121 (1), 54-63 (2013)
Title The nuclease hSNM1B/Apollo is linked to the Fanconi anemia pathway via its interaction with FANCP/SLX4 .
Author Salewsky,B., Schmiester,M., Schindler,D., Digweed,M. and Demuth,I.
Journal Hum. Mol. Genet. 21 (22), 4948-4956 (2012)
Title Analysis of SLX4/FANCP in non-BRCA1/2-mutated breast cancer families .
Author Fernandez-Rodriguez,J., Quiles,F., Blanco,I., Teule,A., Feliubadalo,L., Valle,J.D., Salinas,M., Izquierdo,A., Darder,E., Schindler,D., Capella,G., Brunet,J., Lazaro,C. and Pujana,M.A.
Journal BMC Cancer 12, 84 (2012)
Title Sequencing analysis of SLX4/FANCP gene in Italian familial breast cancer cases .
Author Catucci,I., Colombo,M., Verderio,P., Bernard,L., Ficarazzi,F., Mariette,F., Barile,M., Peissel,B., Cattaneo,E., Manoukian,S., Radice,P. and Peterlongo,P.
Journal PLoS ONE 7 (2), E31038 (2012)
Title Mutation analysis of the SLX4/FANCP gene in hereditary breast cancer .
Author Landwehr,R., Bogdanova,N.V., Antonenkova,N., Meyer,A., Bremer,M., Park-Simon,T.W., Hillemanns,P., Karstens,J.H., Schindler,D. and Dork,T.
Journal Breast Cancer Res. Treat. 130 (3), 1021-1028 (2011)
Title Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases .
Author Fekairi,S., Scaglione,S., Chahwan,C., Taylor,E.R., Tissier,A., Coulon,S., Dong,M.Q., Ruse,C., Yates,J.R. III, Russell,P., Fuchs,R.P., McGowan,C.H. and Gaillard,P.H.
Journal Cell 138 (1), 78-89 (2009)
Title Mammalian BTBD12/SLX4 assembles a Holliday junction resolvase and is required for DNA repair .
Author Svendsen,J.M., Smogorzewska,A., Sowa,M.E., O'Connell,B.C., Gygi,S.P., Elledge,S.J. and Harper,J.W.
Journal Cell 138 (1), 63-77 (2009)
Title Drosophila MUS312 and the vertebrate ortholog BTBD12 interact with .
Author Andersen,S.L., Bergstralh,D.T., Kohl,K.P., LaRocque,J.R., Moore,C.B. and Sekelsky,J.
Journal Mol. Cell 35 (1), 128-135 (2009)
Title Coordination of structure-specific nucleases by human SLX4/BTBD12 is required for DNA repair .
Author Munoz,I.M., Hain,K., Declais,A.C., Gardiner,M., Toh,G.W., Sanchez-Pulido,L., Heuckmann,J.M., Toth,R., Macartney,T., Eppink,B., Kanaar,R., Ponting,C.P., Lilley,D.M. and Rouse,J.
Journal Mol. Cell 35 (1), 116-127 (2009)
Title The sequence and analysis of duplication-rich human chromosome 16 .
Author Martin,J., Han,C., Gordon,L.A., Terry,A., Prabhakar,S., She,X., Xie,G., Hellsten,U., Chan,Y.M., Altherr,M., Couronne,O., Aerts,A., Bajorek,E., Black,S., Blumer,H., Branscomb,E., Brown,N.C., Bruno,W.J., Buckingham,J.M., Callen,D.F., Campbell,C.S., Campbell,M.L., Campbell,E.W., Caoile,C., Challacombe,J.F., Chasteen,L.A., Chertkov,O., Chi,H.C., Christensen,M., Clark,L.M., Cohn,J.D., Denys,M., Detter,J.C., Dickson,M., Dimitrijevic-Bussod,M., Escobar,J., Fawcett,J.J., Flowers,D., Fotopulos,D., Glavina,T., Gomez,M., Gonzales,E., Goodstein,D., Goodwin,L.A., Grady,D.L., Grigoriev,I., Groza,M., Hammon,N., Hawkins,T., Haydu,L., Hildebrand,C.E., Huang,W., Israni,S., Jett,J., Jewett,P.B., Kadner,K., Kimball,H., Kobayashi,A., Krawczyk,M.C., Leyba,T., Longmire,J.L., Lopez,F., Lou,Y., Lowry,S., Ludeman,T., Manohar,C.F., Mark,G.A., McMurray,K.L., Meincke,L.J., Morgan,J., Moyzis,R.K., Mundt,M.O., Munk,A.C., Nandkeshwar,R.D., Pitluck,S., Pollard,M., Predki,P., Parson-Quintana,B., Ramirez,L., Rash,S., Retterer,J., Ricke,D.O., Robinson,D.L., Rodriguez,A., Salamov,A., Saunders,E.H., Scott,D., Shough,T., Stallings,R.L., Stalvey,M., Sutherland,R.D., Tapia,R., Tesmer,J.G., Thayer,N., Thompson,L.S., Tice,H., Torney,D.C., Tran-Gyamfi,M., Tsai,M., Ulanovsky,L.E., Ustaszewska,A., Vo,N., White,P.S., Williams,A.L., Wills,P.L., Wu,J.R., Wu,K., Yang,J., Dejong,P., Bruce,D., Doggett,N.A., Deaven,L., Schmutz,J., Grimwood,J., Richardson,P., Rokhsar,D.S., Eichler,E.E., Gilna,P., Lucas,S.M., Myers,R.M., Rubin,E.M. and Pennacchio,L.A.
Journal Nature 432 (7020), 988-994 (2004)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.