• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 3 (EMR3), mRNA.


RefSeq Accession Definition Services Price Order
NM_032571 Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 3 (EMR3), mRNA. ORF Sequence $568.11
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_032571.3, 133930785
Length 2310 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 3 (EMR3), mRNA.
Product EGF-like module-containing mucin-like hormone receptor-like 3 precursor
Comment

Summary: This gene encodes a member of the class B seven-span transmembrane (TM7) receptor family expressed predominantly by cells of the immune system. Family members are characterized by an extended extracellular region with a variable number of N-terminal epidermal growth factor (EGF)-like domains coupled to a TM7 domain via a mucin-like spacer domain. This gene is closely linked to the gene encoding egf-like molecule containing mucin-like hormone receptor 2 on chromosome 19. This protein may play a role in myeloid-myeloid interactions during immune and inflammatory responses. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: BC142639.1, AK290909.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025088 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_115960.2
CDS 149..2107
Misc Feature(1)74..76
Misc Feature(2)74..76
Misc Feature(3)347..460
Misc Feature(4)order(347..349,356..358,407..409)
Misc Feature(5)569..571
Misc Feature(6)1058..1183
Misc Feature(7)1160..1165
Misc Feature(8)1205..1930
Misc Feature(9)1220..1282
Misc Feature(10)1316..1378
Misc Feature(11)1397..1459
Misc Feature(12)1541..1603
Misc Feature(13)1673..1735
Misc Feature(14)1820..1882
Misc Feature(15)1889..1951
Exon (1)1..173
Gene:EMR3
Gene Synonym:EMR3
Exon (2)174..224
Gene:EMR3
Gene Synonym:EMR3
Exon (3)225..347
Gene:EMR3
Gene Synonym:EMR3
Exon (4)348..503
Gene:EMR3
Gene Synonym:EMR3
Exon (5)504..541
Gene:EMR3
Gene Synonym:EMR3
Exon (6)542..725
Gene:EMR3
Gene Synonym:EMR3
Exon (7)726..845
Gene:EMR3
Gene Synonym:EMR3
Exon (8)846..1030
Gene:EMR3
Gene Synonym:EMR3
Exon (9)1031..1198
Gene:EMR3
Gene Synonym:EMR3
Exon (10)1199..1396
Gene:EMR3
Gene Synonym:EMR3
Exon (11)1397..1632
Gene:EMR3
Gene Synonym:EMR3
Exon (12)1633..1699
Gene:EMR3
Gene Synonym:EMR3
Exon (13)1700..1791
Gene:EMR3
Gene Synonym:EMR3
Exon (14)1792..1960
Gene:EMR3
Gene Synonym:EMR3
Exon (15)1961..2068
Gene:EMR3
Gene Synonym:EMR3
Exon (16)2069..2301
Gene:EMR3
Gene Synonym:EMR3
Translation MQGPLLLPGLCFLLSLFGAVTQKTKTSCAKCPPNASCVNNTHCTCNHGYTSGSGQKLFTF PLETCNDINECTPPYSVYCGFNAVCYNVEGSFYCQCVPGYRLHSGNEQFSNSNENTCQDT TSSKTTEGRKELQKIVDKFESLLTNQTLWRTEGRQEISSTATTILRDVESKVLETALKDP EQKVLKIQNDSVAIETQAITDNCSEERKTFNLNVQMNSMDIRCSDIIQGDTQGPSAIAFI SYSSLGNIINATFFEEMDKKDQVYLNSQVVSAAIGPKRNVSLSKSVTLTFQHVKMTPSTK KVFCVYWKSTGQGSQWSRDGCFLIHVNKSHTMCNCSHLSSFAVLMALTSQEEDPVLTVIT YVGLSVSLLCLLLAALTFLLCKAIRNTSTSLHLQLSLCLFLAHLLFLVGIDRTEPKVLCS IIAGALHYLYLAAFTWMLLEGVHLFLTARNLTVVNYSSINRLMKWIMFPVGYGVPAVTVA ISAASWPHLYGTADRCWLHLDQGFMWSFLGPVCAIFSANLVLFILVFWILKRKLSSLNSE VSTIQNTRMLAFKATAQLFILGCTWCLGLLQVGPAAQVMAYLFTIINSLQGFFIFLVYCL LSQQVQKQYQKWFREIVKSKSESETYTLSSKMGPDSKPSEGDVFPGQVKRKY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(162)-t, adbSNP:201487935
complement(173)-g, cdbSNP:181921684
complement(221)-dbSNP:
complement(221)-t, cdbSNP:144197422
complement(296)-dbSNP:
complement(296)-t, cdbSNP:201149497
complement(309)-t, cdbSNP:148627169
complement(334)-t, cdbSNP:202239062
complement(339)-g, adbSNP:200473707
complement(344)-t, cdbSNP:202140919
complement(347)-t, cdbSNP:200584143
complement(400)-dbSNP:
complement(400)-t, cdbSNP:61729084
complement(412)-g, adbSNP:150826128
complement(413)-t, cdbSNP:61729085
complement(459..460)-, gdbSNP:34172648
complement(481)-g, adbSNP:142306281
complement(503)-g, cdbSNP:116952654
complement(521)-dbSNP:
complement(521)-t, gdbSNP:114104678
complement(527)-g, cdbSNP:4606855
complement(550)-dbSNP:
complement(550)-c, adbSNP:138910897
complement(561)-t, cdbSNP:183697632
complement(568)-t, cdbSNP:201504655
complement(578)-t, cdbSNP:111665529
complement(635)-t, cdbSNP:200661240
complement(644)-g, adbSNP:202129375
complement(645)-t, cdbSNP:147235913
complement(649)-g, adbSNP:191423923
complement(658)-t, cdbSNP:143842724
complement(742)-dbSNP:
complement(742)-t, cdbSNP:112595913
complement(787)-g, adbSNP:201490623
complement(809)-t, cdbSNP:199514629
complement(819)-t, cdbSNP:113225443
complement(855)-dbSNP:
complement(855)-g, adbSNP:34226397
complement(935)-t, cdbSNP:150299594
complement(986)-t, cdbSNP:200966967
complement(1008)-g, adbSNP:192735238
complement(1039)-dbSNP:
complement(1039)-g, adbSNP:112147214
complement(1040)-t, adbSNP:145101518
complement(1082)-t, gdbSNP:192329346
complement(1114)-g, adbSNP:149623759
complement(1116)-g, adbSNP:141371829
complement(1124)-t, cdbSNP:146634810
complement(1210)-dbSNP:
complement(1210)-g, adbSNP:144458654
complement(1231)-g, adbSNP:141113162
complement(1232)-t, cdbSNP:149010185
complement(1261)-g, adbSNP:145693240
complement(1267)-t, cdbSNP:201409408
complement(1269)-g, adbSNP:146538980
complement(1270)-t, cdbSNP:144211355
complement(1272)-t, gdbSNP:139751044
complement(1283)-g, cdbSNP:59183049
complement(1285)-g, adbSNP:202133610
complement(1302)-t, cdbSNP:8102646
complement(1308)-g, adbSNP:140552399
complement(1335)-g, adbSNP:200188037
complement(1336)-t, cdbSNP:190395132
complement(1370)-t, cdbSNP:202195537
complement(1417)-dbSNP:
complement(1417)-g, adbSNP:201350463
complement(1418)-t, cdbSNP:146799017
complement(1445)-t, cdbSNP:200012041
complement(1493)-g, adbSNP:149794291
complement(1502)-t, gdbSNP:200162165
complement(1524)-g, adbSNP:200566145
complement(1548)-g, adbSNP:143690127
complement(1558)-g, adbSNP:201863044
complement(1574)-t, cdbSNP:35094696
complement(1613)-g, adbSNP:182087961
complement(1622)-t, cdbSNP:144427102
complement(1631)-g, adbSNP:149254238
complement(1632)-t, cdbSNP:138445869
complement(1714)-dbSNP:
complement(1714)-c, adbSNP:144722260
complement(1716)-c, adbSNP:142461083
complement(1733)-t, gdbSNP:138384322
complement(1837)-dbSNP:
complement(1837)-g, adbSNP:145814654
complement(1851)-t, cdbSNP:140590698
complement(1869)-g, adbSNP:78700925
complement(1872)-g, cdbSNP:143228360
complement(1891)-t, gdbSNP:200055618
complement(1991)-dbSNP:
complement(1991)-t, cdbSNP:201958148
complement(1996)-t, gdbSNP:147270469
complement(1997)-t, cdbSNP:149148345
complement(2040)-t, adbSNP:199670503
complement(2046)-t, cdbSNP:117374816
complement(2056)-t, cdbSNP:61729083
complement(2057)-t, cdbSNP:139987545
complement(2165)-g, cdbSNP:11666584
complement(2243)-t, cdbSNP:2482
Gene SymbolEMR3
Gene SynonymEMR3
Chromosome19
Locus Map19p13.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_032571 Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 3 (EMR3), mRNA. Full Length $669.90
ORF Sequence $568.11
Title EMR-3: a potential mediator of invasive phenotypic variation in glioblastoma and novel therapeutic target .
Author Kane,A.J., Sughrue,M.E., Rutkowski,M.J., Phillips,J.J. and Parsa,A.T.
Journal Neuroreport 21 (16), 1018-1022 (2010)
Title New genetic associations detected in a host response study to hepatitis B vaccine .
Author Davila,S., Froeling,F.E., Tan,A., Bonnard,C., Boland,G.J., Snippe,H., Hibberd,M.L. and Seielstad,M.
Journal Genes Immun. 11 (3), 232-238 (2010)
Title Gene transcription changes in asthmatic chronic rhinosinusitis with nasal polyps and comparison to those in atopic dermatitis .
Author Plager,D.A., Kahl,J.C., Asmann,Y.W., Nilson,A.E., Pallanch,J.F., Friedman,O. and Kita,H.
Journal PLoS ONE 5 (7), E11450 (2010)
Title The human EGF-TM7 receptor EMR3 is a marker for mature granulocytes .
Author Matmati,M., Pouwels,W., van Bruggen,R., Jansen,M., Hoek,R.M., Verhoeven,A.J. and Hamann,J.
Journal J. Leukoc. Biol. 81 (2), 440-448 (2007)
Title The human and mouse repertoire of the adhesion family of G-protein-coupled receptors .
Author Bjarnadottir,T.K., Fredriksson,R., Hoglund,P.J., Gloriam,D.E., Lagerstrom,M.C. and Schioth,H.B.
Journal Genomics 84 (1), 23-33 (2004)
Title Human epidermal growth factor (EGF) module-containing mucin-like hormone receptor 3 is a new member of the EGF-TM7 family that recognizes a ligand on human macrophages and activated neutrophils .
Author Stacey,M., Lin,H.H., Hilyard,K.L., Gordon,S. and McKnight,A.J.
Journal J. Biol. Chem. 276 (22), 18863-18870 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878