• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 3 (EMR3), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu05054 Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 3 (EMR3), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu05054C Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 3 (EMR3), transcript variant 1, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_032571.4, 574584841
Length 1959 bp
Structure linear
Update Date 26-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens egf-like module containing, mucin-like, hormone receptor-like 3 (EMR3), transcript variant 1, mRNA.
Product EGF-like module-containing mucin-like hormone receptor-like 3 isoform 1 precursor
Comment

Summary: This gene encodes a member of the class B seven-span transmembrane (TM7) receptor family expressed predominantly by cells of the immune system. Family members are characterized by an extended extracellular region with a variable number of N-terminal epidermal growth factor (EGF)-like domains coupled to a TM7 domain via a mucin-like spacer domain. This gene is closely linked to the gene encoding egf-like molecule containing mucin-like hormone receptor 2 on chromosome 19. This protein may play a role in myeloid-myeloid interactions during immune and inflammatory responses. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2014].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1).


##Evidence-Data-START## Transcript exon combination :: BC142639.1, AF239764.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025091 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_115960.2
CDS 149..2107
Misc Feature(1)74..76
Misc Feature(2)347..460
Misc Feature(3)order(347..349,356..358,407..409)
Misc Feature(4)569..571
Misc Feature(5)1058..1183
Misc Feature(6)1205..1930
Exon (1)1..173
Gene:EMR3
Gene Synonym:EMR3
Exon (2)174..224
Gene:EMR3
Gene Synonym:EMR3
Exon (3)225..347
Gene:EMR3
Gene Synonym:EMR3
Exon (4)348..503
Gene:EMR3
Gene Synonym:EMR3
Exon (5)504..541
Gene:EMR3
Gene Synonym:EMR3
Exon (6)542..725
Gene:EMR3
Gene Synonym:EMR3
Exon (7)726..845
Gene:EMR3
Gene Synonym:EMR3
Exon (8)846..1030
Gene:EMR3
Gene Synonym:EMR3
Exon (9)1031..1198
Gene:EMR3
Gene Synonym:EMR3
Exon (10)1199..1396
Gene:EMR3
Gene Synonym:EMR3
Exon (11)1397..1632
Gene:EMR3
Gene Synonym:EMR3
Exon (12)1633..1699
Gene:EMR3
Gene Synonym:EMR3
Exon (13)1700..1791
Gene:EMR3
Gene Synonym:EMR3
Exon (14)1792..1960
Gene:EMR3
Gene Synonym:EMR3
Exon (15)1961..2068
Gene:EMR3
Gene Synonym:EMR3
Exon (16)2069..2423
Gene:EMR3
Gene Synonym:EMR3
Translation MQGPLLLPGLCFLLSLFGAVTQKTKTSCAKCPPNASCVNNTHCTCNHGYTSGSGQKLFTF PLETCNDINECTPPYSVYCGFNAVCYNVEGSFYCQCVPGYRLHSGNEQFSNSNENTCQDT TSSKTTEGRKELQKIVDKFESLLTNQTLWRTEGRQEISSTATTILRDVESKVLETALKDP EQKVLKIQNDSVAIETQAITDNCSEERKTFNLNVQMNSMDIRCSDIIQGDTQGPSAIAFI SYSSLGNIINATFFEEMDKKDQVYLNSQVVSAAIGPKRNVSLSKSVTLTFQHVKMTPSTK KVFCVYWKSTGQGSQWSRDGCFLIHVNKSHTMCNCSHLSSFAVLMALTSQEEDPVLTVIT YVGLSVSLLCLLLAALTFLLCKAIRNTSTSLHLQLSLCLFLAHLLFLVGIDRTEPKVLCS IIAGALHYLYLAAFTWMLLEGVHLFLTARNLTVVNYSSINRLMKWIMFPVGYGVPAVTVA ISAASWPHLYGTADRCWLHLDQGFMWSFLGPVCAIFSANLVLFILVFWILKRKLSSLNSE VSTIQNTRMLAFKATAQLFILGCTWCLGLLQVGPAAQVMAYLFTIINSLQGFFIFLVYCL LSQQVQKQYQKWFREIVKSKSESETYTLSSKMGPDSKPSEGDVFPGQVKRKY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(72)-dbSNP:
complement(72)-t, cdbSNP:372686132
complement(127)-t, cdbSNP:370548709
complement(162)-t, adbSNP:201487935
complement(173)-g, cdbSNP:181921684
complement(221)-dbSNP:
complement(221)-t, cdbSNP:144197422
complement(248)-dbSNP:
complement(248)-t, cdbSNP:371686982
complement(256)-g, adbSNP:368054080
complement(296)-t, cdbSNP:201149497
complement(309)-t, cdbSNP:148627169
complement(334)-t, cdbSNP:202239062
complement(339)-g, adbSNP:200473707
complement(344)-t, cdbSNP:202140919
complement(347)-t, cdbSNP:200584143
complement(396)-dbSNP:
complement(396)-g, adbSNP:368262404
complement(400)-t, cdbSNP:61729084
complement(412)-g, adbSNP:150826128
complement(413)-t, cdbSNP:61729085
complement(433)-t, cdbSNP:375700065
complement(459..460)-, gdbSNP:34172648
complement(481)-g, adbSNP:142306281
complement(495)-g, adbSNP:371039028
complement(503)-g, cdbSNP:116952654
complement(521)-dbSNP:
complement(521)-t, gdbSNP:114104678
complement(527)-g, cdbSNP:4606855
complement(550)-dbSNP:
complement(550)-c, adbSNP:138910897
complement(561)-t, cdbSNP:183697632
complement(568)-t, cdbSNP:201504655
complement(578)-t, cdbSNP:111665529
complement(635)-t, cdbSNP:200661240
complement(644)-g, adbSNP:202129375
complement(645)-t, cdbSNP:147235913
complement(649)-g, adbSNP:191423923
complement(658)-t, cdbSNP:143842724
complement(715)-g, adbSNP:372612623
complement(742)-dbSNP:
complement(742)-t, cdbSNP:112595913
complement(787)-g, adbSNP:201490623
complement(788)-t, cdbSNP:370544138
complement(809)-t, cdbSNP:199514629
complement(819)-t, cdbSNP:113225443
complement(845)-c, adbSNP:373403949
complement(855)-dbSNP:
complement(855)-g, adbSNP:34226397
complement(872)-g, adbSNP:373067590
complement(935)-t, cdbSNP:150299594
complement(950)-g, adbSNP:369269000
complement(986)-t, cdbSNP:200966967
complement(1008)-g, adbSNP:192735238
complement(1025)-t, cdbSNP:375117467
complement(1039)-dbSNP:
complement(1039)-g, adbSNP:112147214
complement(1040)-t, adbSNP:145101518
complement(1076)-t, cdbSNP:367812454
complement(1082)-t, gdbSNP:192329346
complement(1114)-g, adbSNP:149623759
complement(1116)-g, adbSNP:141371829
complement(1124)-t, cdbSNP:146634810
complement(1210)-dbSNP:
complement(1210)-g, adbSNP:144458654
complement(1231)-g, adbSNP:141113162
complement(1232)-t, cdbSNP:149010185
complement(1261)-g, adbSNP:145693240
complement(1264)-g, adbSNP:267605309
complement(1267)-t, cdbSNP:201409408
complement(1269)-g, adbSNP:146538980
complement(1270)-t, cdbSNP:144211355
complement(1272)-t, gdbSNP:139751044
complement(1283)-g, cdbSNP:59183049
complement(1285)-g, adbSNP:202133610
complement(1302)-t, cdbSNP:8102646
complement(1302)-t, cdbSNP:45508602
complement(1308)-g, adbSNP:140552399
complement(1322)-g, adbSNP:376742705
complement(1326)-t, adbSNP:375614211
complement(1335)-g, adbSNP:200188037
complement(1336)-t, cdbSNP:190395132
complement(1370)-t, cdbSNP:202195537
complement(1383)-t, cdbSNP:377703147
complement(1417)-dbSNP:
complement(1417)-g, adbSNP:201350463
complement(1418)-t, cdbSNP:146799017
complement(1445)-t, cdbSNP:200012041
complement(1493)-g, adbSNP:149794291
complement(1502)-t, gdbSNP:200162165
complement(1524)-g, adbSNP:200566145
complement(1548)-g, adbSNP:143690127
complement(1558)-g, adbSNP:201863044
complement(1563)-t, cdbSNP:371350366
complement(1573)-g, adbSNP:367693909
complement(1574)-t, cdbSNP:35094696
complement(1596)-g, adbSNP:376296541
complement(1612)-g, adbSNP:371645604
complement(1613)-g, adbSNP:182087961
complement(1618)-g, adbSNP:368642635
complement(1622)-t, cdbSNP:144427102
complement(1631)-g, adbSNP:149254238
complement(1632)-t, cdbSNP:138445869
complement(1692)-dbSNP:
complement(1692)-g, adbSNP:376096757
complement(1716)-dbSNP:
complement(1716)-c, adbSNP:142461083
complement(1724)-c, adbSNP:373143666
complement(1733)-t, gdbSNP:138384322
complement(1811)-dbSNP:
complement(1811)-t, adbSNP:375553360
complement(1833)-t, cdbSNP:373437727
complement(1837)-g, adbSNP:145814654
complement(1851)-t, cdbSNP:140590698
complement(1869)-g, adbSNP:78700925
complement(1872)-g, cdbSNP:143228360
complement(1891)-t, gdbSNP:200055618
complement(1979)-dbSNP:
complement(1979)-t, cdbSNP:374894225
complement(1991)-t, cdbSNP:201958148
complement(1996)-t, gdbSNP:147270469
complement(1997)-t, cdbSNP:149148345
complement(2020)-t, cdbSNP:368065969
complement(2040)-t, adbSNP:199670503
complement(2046)-t, cdbSNP:117374816
complement(2056)-t, cdbSNP:61729083
complement(2057)-t, cdbSNP:139987545
complement(2065)-g, adbSNP:376729505
complement(2165)-g, cdbSNP:11666584
complement(2174)-t, cdbSNP:376637291
complement(2243)-t, cdbSNP:2482
Gene SymbolEMR3
Gene SynonymEMR3
Chromosome19
Locus Map19p13.1
Title EMR-3: a potential mediator of invasive phenotypic variation in glioblastoma and novel therapeutic target .
Author Kane AJ, Sughrue ME, Rutkowski MJ, Phillips JJ and Parsa AT.
Journal Neuroreport 21 (16), 1018-1022 (2010)
Title New genetic associations detected in a host response study to hepatitis B vaccine .
Author Davila S, Froeling FE, Tan A, Bonnard C, Boland GJ, Snippe H, Hibberd ML and Seielstad M.
Journal Genes Immun. 11 (3), 232-238 (2010)
Title Gene transcription changes in asthmatic chronic rhinosinusitis with nasal polyps and comparison to those in atopic dermatitis .
Author Plager DA, Kahl JC, Asmann YW, Nilson AE, Pallanch JF, Friedman O and Kita H.
Journal PLoS ONE 5 (7), E11450 (2010)
Title The human EGF-TM7 receptor EMR3 is a marker for mature granulocytes .
Author Matmati M, Pouwels W, van Bruggen R, Jansen M, Hoek RM, Verhoeven
Journal J. Leukoc. Biol. 81 (2), 440-448 (2007)
Title The human and mouse repertoire of the adhesion family of G-protein-coupled receptors .
Author Bjarnadottir TK, Fredriksson R, Hoglund PJ, Gloriam DE, Lagerstrom
Journal Genomics 84 (1), 23-33 (2004)
Title Human epidermal growth factor (EGF) module-containing mucin-like hormone receptor 3 is a new member of the EGF-TM7 family that recognizes a ligand on human macrophages and activated neutrophils .
Author Stacey M, Lin HH, Hilyard KL, Gordon S and McKnight AJ.
Journal J. Biol. Chem. 276 (22), 18863-18870 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.