• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens receptor-associated protein of the synapse (RAPSN), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu44937 Homo sapiens receptor-associated protein of the synapse (RAPSN), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu44937C Homo sapiens receptor-associated protein of the synapse (RAPSN), transcript variant 2, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_032645.4, 328802669
Length 1062 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens receptor-associated protein of the synapse (RAPSN), transcript variant 2, mRNA.
Product 43 kDa receptor-associated protein of the synapse isoform 2
Comment

Summary: This gene encodes a member of a family of proteins that are receptor associated proteins of the synapse. The encoded protein contains a conserved cAMP-dependent protein kinase phosphorylation site, and plays a critical role in clustering and anchoring nicotinic acetylcholine receptors at synaptic sites by linking the receptors to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin. Mutations in this gene may play a role in postsynaptic congenital myasthenic syndromes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Apr 2011].


Transcript Variant: This variant (2) lacks two consecutive exons in the coding region, but maintains the reading frame, compared to variant 1. The encoded isoform (2) is shorter than isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_116034.2
CDS 215..1276
Misc Feature(1)43
Misc Feature(2)152..154
Misc Feature(3)215..454
Misc Feature(4)215..454
Misc Feature(5)218..220
Misc Feature(6)584..919
Misc Feature(7)order(584..589,593..598,605..610,713..718,722..727,
Misc Feature(8)order(602..604,638..640,650..652,659..661,722..724,
Misc Feature(9)824..>1003
Misc Feature(10)1124..1252
Misc Feature(11)order(1124..1126,1133..1135,1181..1183,1187..1189,
Exon (1)1..406
Gene:RAPSN
Gene Synonym:RAPSYN; RNF205
Exon (2)407..745
Gene:RAPSN
Gene Synonym:RAPSYN; RNF205
Exon (3)746..904
Gene:RAPSN
Gene Synonym:RAPSYN; RNF205
Exon (4)905..1003
Gene:RAPSN
Gene Synonym:RAPSYN; RNF205
Exon (5)1004..1203
Gene:RAPSN
Gene Synonym:RAPSYN; RNF205
Exon (6)1204..1494
Gene:RAPSN
Gene Synonym:RAPSYN; RNF205
Translation MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLVTAHSEMGRYK EMLKFAVVQIDTARELEDADFLLESYLNLARSNEKLCEFHKTISYCKTCLGLPGTRAGAQ LGGQVSLSMGNAFLGLSVFQKALESFEKALRYAHNNDDAMLECRVCCSLGSFYAQVKDYE KALFFPCKAAELVNNYGKGWSLKYRAMSQYHMAVAYRLLGRLGSAMECCEESMKIALQHG DRPLQALCLLCFADIHRSRGDLELSQLKLHCLSESIYRSKGLQRELRAHVVRFHECVEET ELYCGLCGESIGEKNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(26)-dbSNP:
complement(26)-g, adbSNP:79691556
complement(27)-t, cdbSNP:375865920
complement(99)-t, gdbSNP:141786680
complement(114)-g, adbSNP:78771161
complement(143)-g, adbSNP:117947983
163+a, tdbSNP:1050935
complement(192)-t, cdbSNP:370356548
complement(220)-t, cdbSNP:201291481
236+a, cdbSNP:11556408
255+c, tdbSNP:104894300
complement(290)-g, adbSNP:202091676
complement(296)-c, adbSNP:199984356
complement(299)-g, adbSNP:376422329
complement(325)-t, cdbSNP:146825957
complement(338)-g, adbSNP:201197735
complement(339)-t, cdbSNP:201399991
complement(354)-t, cdbSNP:201725858
complement(376)-t, cdbSNP:72905825
complement(386)-t, cdbSNP:34312154
complement(387)-c, adbSNP:373437117
complement(410)-dbSNP:
complement(410)-t, cdbSNP:145197671
412+c, tdbSNP:1131389
complement(416)-t, cdbSNP:200892332
complement(425)-t, cdbSNP:150051760
complement(430)-t, cdbSNP:141877523
complement(439)-t, cdbSNP:147923114
complement(455)-g, adbSNP:57878668
478+a, cdbSNP:104894299
complement(486)-t, cdbSNP:375218091
complement(494)-t, cdbSNP:200550567
complement(506)-t, cdbSNP:367709865
complement(516)-t, cdbSNP:374361284
complement(577)-g, adbSNP:190548363
complement(578)-t, cdbSNP:150756111
626+a, gdbSNP:35810986
630+c, tdbSNP:121909256
complement(633)-t, cdbSNP:372114714
complement(639)-t, gdbSNP:368695664
complement(665)-g, adbSNP:148600999
complement(670)-g, adbSNP:7111873
complement(671)-t, cdbSNP:142635726
688+c, tdbSNP:56245238
complement(689)-t, cdbSNP:199506866
698+a, gdbSNP:121909255
704+c, tdbSNP:104894294
complement(705)-t, cdbSNP:374588028
complement(706)-g, adbSNP:146237774
780+dbSNP:
780+c, tdbSNP:121909257
complement(788)-g, adbSNP:376041895
complement(814)-t, cdbSNP:200603527
complement(828)-g, adbSNP:34625105
complement(854)-t, cdbSNP:201124957
complement(881)-t, cdbSNP:138863694
complement(973)-dbSNP:
complement(973)-g, adbSNP:111909765
complement(984)-t, cdbSNP:200066826
complement(989)-g, adbSNP:150207592
complement(1023)-dbSNP:
complement(1023)-t, cdbSNP:371178161
complement(1034)-c, adbSNP:201947904
complement(1039)-g, adbSNP:376829572
complement(1078)-t, cdbSNP:149683345
complement(1099)-g, cdbSNP:373648358
complement(1126)-g, adbSNP:150934532
complement(1127)-t, cdbSNP:372865599
complement(1135)-g, adbSNP:139525851
complement(1136)-t, cdbSNP:369104346
complement(1150)-g, adbSNP:150503333
complement(1163)-g, adbSNP:145507075
complement(1180)-t, cdbSNP:386607679
complement(1180)-g, adbSNP:7126210
complement(1218)-dbSNP:
complement(1218)-t, cdbSNP:370123138
complement(1226)-g, adbSNP:201796294
complement(1227)-t, cdbSNP:139398367
complement(1246)-g, cdbSNP:77410879
complement(1255)-g, adbSNP:146285971
complement(1312)-g, adbSNP:375413349
1333+c, tdbSNP:45617144
complement(1372)-t, cdbSNP:150020304
complement(1436..1437)-, gdbSNP:139608736
complement(1445..1446)-, aadbSNP:376838179
complement(1483)-t, gdbSNP:73459751
Gene SymbolRAPSN
Gene SynonymRAPSYN; RNF205
Chromosome11
Locus Map11p11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_005055 Homo sapiens receptor-associated protein of the synapse (RAPSN), transcript variant 1, mRNA. On-demand $219.00 7-9
NM_032645 Homo sapiens receptor-associated protein of the synapse (RAPSN), transcript variant 2, mRNA. On-demand $219.00 7-9
XM_005253042 PREDICTED: Homo sapiens receptor-associated protein of the synapse (RAPSN), transcript variant X1, mRNA. On-demand $219.00 7-9
XM_005253043 PREDICTED: Homo sapiens receptor-associated protein of the synapse (RAPSN), transcript variant X2, mRNA. On-demand $219.00 7-9
Title A novel mutation in the TPR6 domain of the RAPSN gene associated with congenital myasthenic syndrome .
Author Leshinsky-Silver E, Shapira D, Yosovitz K, Ginsberg M, Lerman-Sagie
Journal J. Neurol. Sci. 316 (1-2), 112-115 (2012)
Title Diagnosis of congenital myasthenic syndrome with mutation of the .
Author Gentili A, Ansaloni S, Morello W, Cecini MT, Cordelli DM and Baroncini S.
Journal Eur J Anaesthesiol 28 (10), 748-749 (2011)
Title Investigation for RAPSN and DOK-7 mutations in a cohort of seronegative myasthenia gravis patients .
Author Alseth EH, Maniaol AH, Elsais A, Nakkestad HL, Tallaksen C, Gilhus
Journal Muscle Nerve 43 (4), 574-577 (2011)
Title Regulation of the rapsyn promoter by kaiso and delta-catenin .
Author Rodova M, Kelly KF, VanSaun M, Daniel JM and Werle MJ.
Journal Mol. Cell. Biol. 24 (16), 7188-7196 (2004)
Title Rapsyn mutations in humans cause endplate acetylcholine-receptor deficiency and myasthenic syndrome .
Author Ohno K, Engel AG, Shen XM, Selcen D, Brengman J, Harper CM, Tsujino
Journal Am. J. Hum. Genet. 70 (4), 875-885 (2002)
Title Mechanism of nicotinic acetylcholine receptor cluster formation by rapsyn .
Author Ramarao MK and Cohen JB.
Journal Proc. Natl. Acad. Sci. U.S.A. 95 (7), 4007-4012 (1998)
Title Rapsyn is required for MuSK signaling and recruits synaptic components to a MuSK-containing scaffold .
Author Apel ED, Glass DJ, Moscoso LM, Yancopoulos GD and Sanes JR.
Journal Neuron 18 (4), 623-635 (1997)
Title Cloning of cDNA encoding human rapsyn and mapping of the RAPSN gene locus to chromosome 11p11.2-p11.1 .
Author Buckel A, Beeson D, James M and Vincent A.
Journal Genomics 35 (3), 613-616 (1996)
Title Rapsyn may function as a link between the acetylcholine receptor and the agrin-binding dystrophin-associated glycoprotein complex .
Author Apel ED, Roberds SL, Campbell KP and Merlie JP.
Journal Neuron 15 (1), 115-126 (1995)
Title Congenital Myasthenic Syndromes .
Author Abicht,A., Muller,J. and Lochmuller,H.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.