• THAT   AND
  • THAT   AND


Homo sapiens Berardinelli-Seip congenital lipodystrophy 2 (seipin) (BSCL2), transcript variant 2, mRNA.


RefSeq Accession Definition Sequence Price Select
NM_032667 Homo sapiens Berardinelli-Seip congenital lipodystrophy 2 (seipin) (BSCL2), transcript variant 2, mRNA. Full Lenth $440.80
ORF Sequence $347.13


RefSeq Version NM_032667.6, 325910878
Length 1520 bp
Structure linear
Update Date 15-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens Berardinelli-Seip congenital lipodystrophy 2 (seipin) (BSCL2), transcript variant 2, mRNA.
Product seipin isoform 2
Comment

Summary: This gene encodes the multi-pass transmembrane protein protein seipin. This protein localizes to the endoplasmic reticulum and may be important for lipid droplet morphology. Mutations in this gene have been associated with congenital generalized lipodystrophy type 2 or Berardinelli-Seip syndrome, a rare autosomal recessive disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HNRNPUL2 (heterogeneous nuclear ribonucleoprotein U-like 2).


Transcript Variant: This variant (2) has an alternate 5' exon and uses a downstream AUG start codon, as compared to variant 1. The resulting isoform (2) has a shorter N-terminus, as compared to isoform 1.

RefSeq NP_116056.3
CDS 219..1415
Exon (1)1..113
Exon (2)1..113
Exon (3)114..430
Exon (4)431..512
Exon (5)513..656
Exon (6)657..791
Exon (7)792..889
Exon (8)890..1031
Exon (9)1032..1098
Exon (10)1099..1179
Exon (11)1180..1260
Exon (12)1261..1520
Translation MVNDPPVPALLWAQEVGQVLAGRARRLLLQFGVLFCTILLLLWVSVFLYGSFYYSYMPTV SHLSPVHFYYRTDCDSSTTSLCSFPVANVSLTKGGRDRVLMYGQPYRVTLELELPESPVN QDLGMFLVTISCYTRGGRIISTSSRSVMLHYRSDLLQMLDTLVFSSLLLFGFAEQKQLLE VELYADYRENSYVPTTGAIIEIHSKRIQLYGAYLRIHAHFTGLRYLLYNFPMTCAFIGVA SNFTFLSVIVLFSYMQWVWGGIWPRHRFSLQVNIRKRDNSRKEVQRRISAHQPGPEGQEE STPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDGSGSWEDAALLTE ANLPAPAPASASAPVLETLGSSEPAGGALRQRPTCSSS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolBSCL2
Gene SynonymFLJ16651; GNG3LG; HMN5; MGC4694; SPG17
Chromosome11
Locus Map11q13
All Transcripts NM_032667 , NM_001130702 , NM_001122955
Title N88S mutation in the BSCL2 gene in a Serbian family with distal hereditary motor neuropathy type V or Silver syndrome .
Author Rakocevic-Stojanovic,V., Milic-Rasic,V., Peric,S., Baets,J., Timmerman,V., Dierick,I., Pavlovic,S. and De Jonghe,P.
Journal J. Neurol. Sci. 296 (1-2), 107-109 (2010)
Title Seipin S90L mutation in an Italian family with CMT2/dHMN and pyramidal signs .
Author Luigetti,M., Fabrizi,G.M., Madia,F., Ferrarini,M., Conte,A., Delgrande,A., Tonali,P.A. and Sabatelli,M.
Journal Muscle Nerve 42 (3), 448-451 (2010)
Title Two Japanese infants with congenital generalized lipodystrophy due to BSCL2 mutations .
Author Nishiyama,A., Yagi,M., Awano,H., Okizuka,Y., Maeda,T., Yoshida,S., Takeshima,Y. and Matsuo,M.
Journal Pediatr Int 51 (6), 775-779 (2009)
Title Complementary mutations in seipin gene in a patient with Berardinelli-Seip congenital lipodystrophy and dystonia: phenotype variability suggests multiple roles of seipin gene .
Author Wu,Y.R., Hung,S.I., Chang,Y.C., Chen,S.T., Lin,Y.L. and Chung,W.H.
Journal J. Neurol. Neurosurg. Psychiatr. 80 (10), 1180-1181 (2009)
Title The human lipodystrophy gene product Berardinelli-Seip congenital lipodystrophy 2/seipin plays a key role in adipocyte differentiation .
Author Chen,W., Yechoor,V.K., Chang,B.H., Li,M.V., March,K.L. and Chan,L.
Journal Endocrinology 150 (10), 4552-4561 (2009)
Title Gene and phenotype analysis of congenital generalized lipodystrophy in Japanese: a novel homozygous nonsense mutation in seipin gene .
Author Ebihara,K., Kusakabe,T., Masuzaki,H., Kobayashi,N., Tanaka,T., Chusho,H., Miyanaga,F., Miyazawa,T., Hayashi,T., Hosoda,K., Ogawa,Y. and Nakao,K.
Journal J. Clin. Endocrinol. Metab. 89 (5), 2360-2364 (2004)
Title Heterozygous missense mutations in BSCL2 are associated with distal hereditary motor neuropathy and Silver syndrome .
Author Windpassinger,C., Auer-Grumbach,M., Irobi,J., Patel,H., Petek,E., Horl,G., Malli,R., Reed,J.A., Dierick,I., Verpoorten,N., Warner,T.T., Proukakis,C., Van den Bergh,P., Verellen,C., Van Maldergem,L., Merlini,L., De Jonghe,P., Timmerman,V., Crosby,A.H. and Wagner,K.
Journal Nat. Genet. 36 (3), 271-276 (2004)
Title Phenotypic heterogeneity in body fat distribution in patients with congenital generalized lipodystrophy caused by mutations in the AGPAT2 or seipin genes .
Author Simha,V. and Garg,A.
Journal J. Clin. Endocrinol. Metab. 88 (11), 5433-5437 (2003)
Title Identification of the gene altered in Berardinelli-Seip congenital lipodystrophy on chromosome 11q13 .
Author Magre,J., Delepine,M., Khallouf,E., Gedde-Dahl,T. Jr., Van Maldergem,L., Sobel,E., Papp,J., Meier,M., Megarbane,A., Bachy,A., Verloes,A., d'Abronzo,F.H., Seemanova,E., Assan,R., Baudic,N., Bourut,C., Czernichow,P., Huet,F., Grigorescu,F., de Kerdanet,M., Lacombe,D., Labrune,P., Lanza,M., Loret,H., Matsuda,F., Navarro,J., Nivelon-Chevalier,A., Polak,M., Robert,J.J., Tric,P., Tubiana-Rufi,N., Vigouroux,C., Weissenbach,J., Savasta,S., Maassen,J.A., Trygstad,O., Bogalho,P., Freitas,P., Medina,J.L., Bonnicci,F., Joffe,B.I., Loyson,G., Panz,V.R., Raal,F.J., O'Rahilly,S., Stephenson,T., Kahn,C.R., Lathrop,M. and Capeau,J.
Journal Nat. Genet. 28 (4), 365-370 (2001)
Title The Silver syndrome variant of hereditary spastic paraplegia maps to chromosome 11q12-q14, with evidence for genetic heterogeneity within this subtype .
Author Patel,H., Hart,P.E., Warner,T.T., Houlston,R.S., Patton,M.A., Jeffery,S. and Crosby,A.H.
Journal Am. J. Hum. Genet. 69 (1), 209-215 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878