• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tubulin, alpha 1c (TUBA1C), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu30915 Homo sapiens tubulin, alpha 1c (TUBA1C), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu30915C Homo sapiens tubulin, alpha 1c (TUBA1C), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_032704.3, 142375723
Length 1350 bp
Structure linear
Update Date 01-FEB-2014
Organism Homo sapiens (human)
Definition Homo sapiens tubulin, alpha 1c (TUBA1C), mRNA.
Product tubulin alpha-1C chain
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC005946.1. On Apr 6, 2007 this sequence version replaced gi:31880337.


##Evidence-Data-START## Transcript exon combination :: BC005946.1, BC063036.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END##

RefSeq NP_116093.1
CDS 101..1450
Misc Feature(1)26..28
Misc Feature(2)26..28
Misc Feature(3)101..1444
Misc Feature(4)101..1444
Misc Feature(5)104..1405
Misc Feature(6)order(104..106,695..697,857..862,866..874,878..883,
Misc Feature(7)order(128..136,143..148,305..313,320..322,395..403,
Misc Feature(8)242..244
Misc Feature(9)order(314..319,398..406,413..415,641..643,647..649,
Misc Feature(10)1169..1171
Misc Feature(11)1394..1396
Misc Feature(12)1415..1417
Misc Feature(13)1415..1417
Misc Feature(14)1445..1447
Misc Feature(15)1445..1447
Exon (1)1..103
Gene:TUBA1C
Gene Synonym:bcm948; TUBA6
Exon (2)104..326
Gene:TUBA1C
Gene Synonym:bcm948; TUBA6
Exon (3)327..475
Gene:TUBA1C
Gene Synonym:bcm948; TUBA6
Exon (4)476..1553
Gene:TUBA1C
Gene Synonym:bcm948; TUBA6
Translation MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPAN QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP TVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE AREDMAALEKDYEEVGADSADGEDEGEEY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
38+a, gdbSNP:373112347
47+c, tdbSNP:200286811
49..50+a, gdbSNP:11542117
75+a, gdbSNP:377250068
86+c, gdbSNP:372155310
96+c, tdbSNP:116453112
105+dbSNP:
105+g, tdbSNP:377104935
147+c, tdbSNP:369325723
174+a, gdbSNP:373470317
185+a, gdbSNP:201675442
196+c, tdbSNP:371053275
217+a, cdbSNP:147456707
225+c, tdbSNP:138486283
228+c, gdbSNP:139215369
265+a, gdbSNP:115048428
313+a, gdbSNP:143029653
344+dbSNP:
344+a, gdbSNP:11542122
346+c, tdbSNP:17849881
367+g, tdbSNP:139840621
373+a, gdbSNP:17849882
396+c, tdbSNP:11542118
409+c, tdbSNP:143331299
430+c, tdbSNP:143950344
451+c, tdbSNP:201347417
548+dbSNP:
548+a, gdbSNP:187663409
579+a, gdbSNP:192154754
584+a, gdbSNP:369308226
592+a, gdbSNP:199599214
610+c, tdbSNP:113331886
622+a, gdbSNP:1057748
624+c, tdbSNP:11542119
734+a, cdbSNP:376776166
741+a, gdbSNP:371063872
753+a, gdbSNP:372926418
757+c, tdbSNP:375933607
761+a, cdbSNP:370276397
794+a, gdbSNP:373730264
853+c, tdbSNP:140286355
886+c, tdbSNP:200651108
898+c, tdbSNP:201965403
949+c, tdbSNP:7974831
949+c, tdbSNP:56930686
959+a, tdbSNP:201310100
988+c, tdbSNP:372810412
1066+c, tdbSNP:377596043
1092+c, tdbSNP:200317762
1168+c, tdbSNP:144002178
1195+c, tdbSNP:140582697
1196+a, gdbSNP:146417733
1240+c, tdbSNP:140667726
complement(1242)-t, gdbSNP:11542113
1255+c, tdbSNP:11542115
1268+c, tdbSNP:368180124
1300+a, cdbSNP:138174052
1303+a, gdbSNP:201921449
1348+c, tdbSNP:188605921
1356+c, tdbSNP:377694330
1369+a, gdbSNP:372085305
1373+a, gdbSNP:149194844
1435+c, gdbSNP:371067017
complement(1460)-g, adbSNP:11542114
1461+a, gdbSNP:201038906
1470+c, tdbSNP:376096817
1516+a, gdbSNP:192742751
1521+c, tdbSNP:184192056
1522+a, gdbSNP:375107721
1523+a, tdbSNP:111688827
1543+a, tdbSNP:9668136
Gene SymbolTUBA1C
Gene Synonymbcm948; TUBA6
Chromosome12
Locus Map12q13.12
Title Up-regulation of 42 kDa tubulin alpha-6 chain fragment in well-differentiated hepatocellular carcinoma tissues from patients infected with hepatitis C virus .
Author Kuramitsu Y, Takashima M, Yokoyama Y, Iizuka N, Tamesa T, Akada JK, Wang Y, Toda T, Sakaida I, Okita K, Oka M and Nakamura K.
Journal Anticancer Res. 31 (10), 3331-3336 (2011)
Title HDM2-binding partners: interaction with translation elongation factor EF1alpha .
Author Frum R, Busby SA, Ramamoorthy M, Deb S, Shabanowitz J, Hunt DF and Deb SP.
Journal J. Proteome Res. 6 (4), 1410-1417 (2007)
Title Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress .
Author Guo D, Han J, Adam BL, Colburn NH, Wang MH, Dong Z, Eizirik DL, She
Journal Biochem. Biophys. Res. Commun. 337 (4), 1308-1318 (2005)
Title Immunoaffinity profiling of tyrosine phosphorylation in cancer cells .
Author Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD and Comb MJ.
Journal Nat. Biotechnol. 23 (1), 94-101 (2005)
Title HIV-1 Tat targets microtubules to induce apoptosis, a process promoted by the pro-apoptotic Bcl-2 relative Bim .
Author Chen D, Wang M, Zhou S and Zhou Q.
Journal EMBO J. 21 (24), 6801-6810 (2002)
Title Mutation analysis of 12 candidate genes for distal hereditary motor neuropathy type II (distal HMN II) linked to 12q24.3 .
Author Irobi J, Nelis E, Verhoeven K, De Vriendt E, Dierick I, De Jonghe P, Van Broeckhoven C and Timmerman V.
Journal J. Peripher. Nerv. Syst. 7 (2), 87-95 (2002)
Title HIV-1 rev depolymerizes microtubules to form stable bilayered rings .
Author Watts NR, Sackett DL, Ward RD, Miller MW, Wingfield PT, Stahl SS and Steven AC.
Journal J. Cell Biol. 150 (2), 349-360 (2000)
Title Construction of a human full-length cDNA bank .
Author Kato S, Sekine S, Oh SW, Kim NS, Umezawa Y, Abe N, Yokoyama-Kobayashi M and Aoki T.
Journal Gene 150 (2), 243-250 (1994)
Title Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin .
Author Dawson SJ and White LA.
Journal J. Infect. 24 (3), 317-320 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.