• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens tubulin, alpha 1c (TUBA1C), mRNA.


RefSeq Accession Definition Services Price Order
NM_032704 Homo sapiens tubulin, alpha 1c (TUBA1C), mRNA. ORF Sequence $391.50
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_032704.3, 142375723
Length 1581 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens tubulin, alpha 1c (TUBA1C), mRNA.
Product tubulin alpha-1C chain
Comment

COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC005946.1. On Apr 6, 2007 this sequence version replaced gi:31880337.


Sequence Note: removed 1 base from the 3' end that did not align to the reference genome assembly.


##Evidence-Data-START## Transcript exon combination :: BC005946.1, BC063036.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END##

RefSeq NP_116093.1
CDS 101..1450
Misc Feature(1)26..28
Misc Feature(2)26..28
Misc Feature(3)101..1396
Misc Feature(4)101..1396
Misc Feature(5)104..1396
Misc Feature(6)order(104..106,695..697,857..862,866..874,878..883,
Misc Feature(7)order(128..136,143..148,305..313,320..322,395..403,
Misc Feature(8)242..244
Misc Feature(9)order(314..319,398..406,413..415,641..643,647..649,
Misc Feature(10)1169..1171
Misc Feature(11)1394..1396
Misc Feature(12)1415..1417
Misc Feature(13)1415..1417
Misc Feature(14)1445..1447
Misc Feature(15)1445..1447
Exon (1)1..103
Gene:TUBA1C
Gene Synonym:bcm948; TUBA6
Exon (2)104..326
Gene:TUBA1C
Gene Synonym:bcm948; TUBA6
Exon (3)327..475
Gene:TUBA1C
Gene Synonym:bcm948; TUBA6
Exon (4)476..1553
Gene:TUBA1C
Gene Synonym:bcm948; TUBA6
Translation MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPAN QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP TVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE AREDMAALEKDYEEVGADSADGEDEGEEY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
47+c, tdbSNP:200286811
49..50+a, gdbSNP:11542117
96+c, tdbSNP:116453112
Gene SymbolTUBA1C
Gene Synonymbcm948; TUBA6
Chromosome12
Locus Map12q13.12
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_032704 Homo sapiens tubulin, alpha 1c (TUBA1C), mRNA. Full Length $458.49
ORF Sequence $391.50
Title Up-regulation of 42 kDa tubulin alpha-6 chain fragment in well-differentiated hepatocellular carcinoma tissues from patients infected with hepatitis C virus .
Author Kuramitsu,Y., Takashima,M., Yokoyama,Y., Iizuka,N., Tamesa,T., Akada,J.K., Wang,Y., Toda,T., Sakaida,I., Okita,K., Oka,M. and Nakamura,K.
Journal Anticancer Res. 31 (10), 3331-3336 (2011)
Title HDM2-binding partners: interaction with translation elongation factor EF1alpha .
Author Frum,R., Busby,S.A., Ramamoorthy,M., Deb,S., Shabanowitz,J., Hunt,D.F. and Deb,S.P.
Journal J. Proteome Res. 6 (4), 1410-1417 (2007)
Title Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress .
Author Guo,D., Han,J., Adam,B.L., Colburn,N.H., Wang,M.H., Dong,Z., Eizirik,D.L., She,J.X. and Wang,C.Y.
Journal Biochem. Biophys. Res. Commun. 337 (4), 1308-1318 (2005)
Title Immunoaffinity profiling of tyrosine phosphorylation in cancer cells .
Author Rush,J., Moritz,A., Lee,K.A., Guo,A., Goss,V.L., Spek,E.J., Zhang,H., Zha,X.M., Polakiewicz,R.D. and Comb,M.J.
Journal Nat. Biotechnol. 23 (1), 94-101 (2005)
Title HIV-1 Tat targets microtubules to induce apoptosis, a process promoted by the pro-apoptotic Bcl-2 relative Bim .
Author Chen,D., Wang,M., Zhou,S. and Zhou,Q.
Journal EMBO J. 21 (24), 6801-6810 (2002)
Title Mutation analysis of 12 candidate genes for distal hereditary motor neuropathy type II (distal HMN II) linked to 12q24.3 .
Author Irobi,J., Nelis,E., Verhoeven,K., De Vriendt,E., Dierick,I., De Jonghe,P., Van Broeckhoven,C. and Timmerman,V.
Journal J. Peripher. Nerv. Syst. 7 (2), 87-95 (2002)
Title HIV-1 rev depolymerizes microtubules to form stable bilayered rings .
Author Watts,N.R., Sackett,D.L., Ward,R.D., Miller,M.W., Wingfield,P.T., Stahl,S.S. and Steven,A.C.
Journal J. Cell Biol. 150 (2), 349-360 (2000)
Title Construction of a human full-length cDNA bank .
Author Kato,S., Sekine,S., Oh,S.W., Kim,N.S., Umezawa,Y., Abe,N., Yokoyama-Kobayashi,M. and Aoki,T.
Journal Gene 150 (2), 243-250 (1994)
Title Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin .
Author Dawson,S.J. and White,L.A.
Journal J. Infect. 24 (3), 317-320 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878