• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens lamin B2 (LMNB2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu21383 Homo sapiens lamin B2 (LMNB2), mRNA. pcDNA3.1+-DYK On-demand TBD TBD
OHu21383C Homo sapiens lamin B2 (LMNB2), mRNA. Customized vector On-demand $269.00 TBD

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_032737.3, 388240800
Length 1863 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens lamin B2 (LMNB2), mRNA.
Product lamin-B2
Comment

Summary: This gene encodes a B type nuclear lamin. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. Mutations in this gene are associated with acquired partial lipodystrophy. [provided by RefSeq, May 2012].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_116126.3
CDS 36..1898
Misc Feature(1)33..35
Misc Feature(2)33..35
Misc Feature(3)168..1238
Misc Feature(4)168..1238
Misc Feature(5)1434..1781
Exon (1)1..299
Gene:LMNB2
Gene Synonym:LAMB2; LMN2
Exon (2)300..436
Gene:LMNB2
Gene Synonym:LAMB2; LMN2
Exon (3)437..593
Gene:LMNB2
Gene Synonym:LAMB2; LMN2
Exon (4)594..719
Gene:LMNB2
Gene Synonym:LAMB2; LMN2
Exon (5)720..890
Gene:LMNB2
Gene Synonym:LAMB2; LMN2
Exon (6)891..1016
Gene:LMNB2
Gene Synonym:LAMB2; LMN2
Exon (7)1017..1237
Gene:LMNB2
Gene Synonym:LAMB2; LMN2
Exon (8)1238..1517
Gene:LMNB2
Gene Synonym:LAMB2; LMN2
Exon (9)1518..1625
Gene:LMNB2
Gene Synonym:LAMB2; LMN2
Exon (10)1626..1745
Gene:LMNB2
Gene Synonym:LAMB2; LMN2
Exon (11)1746..1856
Gene:LMNB2
Gene Synonym:LAMB2; LMN2
Exon (12)1857..4644
Gene:LMNB2
Gene Synonym:LAMB2; LMN2
Translation MSPPSPGRRREQRRPRAAATMATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHY IDRVRALELENDRLLLKISEKEEVTTREVSGIKALYESELADARRVLDETARERARLQIE IGKLRAELDEVNKSAKKREGELTVAQGRVKDLESLFHRSEVELAAALSDKRGLESDVAEL RAQLAKAEDGHAVAKKQLEKETLMRVDLENRCQSLQEELDFRKSVFEEEVRETRRRHERR LVEVDSSRQQEYDFKMAQALEELRSQHDEQVRLYKLELEQTYQAKLDSAKLSSDQNDKAA SAAREELKEARMRLESLSYQLSGLQKQASAAEDRIRELEEAMAGERDKFRKMLDAKEQEM TEMRDVMQQQLAEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRATSS SSGSLSATGRLGRSKRKRLEVEEPLGSGPSVLGTGTGGSGGFHLAQQASASGSVSIEEID LEGKFVQLKNNSDKDQSLGNWRIKRQVLEGEEIAYKFTPKYILRAGQMVTVWAAGAGVAH SPPSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENGEEEEEEAEFGE EDLFHQQGDPRTTSRGCYVM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(90)-t, cdbSNP:3764582
complement(107)-c, adbSNP:112445447
177+a, gdbSNP:58992194
complement(233)-t, cdbSNP:147207457
complement(290)-g, cdbSNP:201524951
complement(323)-dbSNP:
complement(323)-g, adbSNP:201605408
complement(326)-t, cdbSNP:143458767
complement(328)-g, adbSNP:200680198
complement(338)-g, adbSNP:137884900
complement(340)-t, cdbSNP:374872016
complement(345)-g, adbSNP:150333146
complement(364)-g, adbSNP:371789042
complement(365)-t, cdbSNP:141214064
complement(370)-t, cdbSNP:367966814
complement(375)-g, adbSNP:375451196
complement(376)-t, cdbSNP:201499035
complement(382)-t, cdbSNP:370820384
complement(422)-g, adbSNP:368379275
complement(437)-dbSNP:
complement(437)-g, adbSNP:148213507
complement(438)-t, cdbSNP:372474156
complement(456)-t, cdbSNP:370270636
complement(463)-g, adbSNP:375961613
complement(464)-t, cdbSNP:372873077
complement(477)-g, adbSNP:369668021
complement(508)-c, adbSNP:375613243
complement(513)-t, cdbSNP:199671950
complement(549)-t, cdbSNP:145110937
complement(564)-t, cdbSNP:200404213
complement(573)-t, gdbSNP:201202521
complement(596)-dbSNP:
complement(596)-g, adbSNP:369856120
complement(603)-t, cdbSNP:377308554
complement(609)-c, adbSNP:112419003
complement(631)-t, cdbSNP:146647837
complement(632)-t, cdbSNP:186368809
complement(650)-g, adbSNP:367692230
complement(701)-t, cdbSNP:376727524
complement(713)-g, adbSNP:182026397
complement(734)-dbSNP:
complement(734)-t, cdbSNP:145894724
complement(735)-g, adbSNP:148936043
complement(750)-g, adbSNP:375872872
complement(774)-t, gdbSNP:149762712
complement(778)-t, cdbSNP:201250275
complement(788)-t, cdbSNP:372552710
complement(812)-t, cdbSNP:368625656
complement(839)-g, adbSNP:150969746
complement(840)-t, cdbSNP:201457236
complement(842)-g, cdbSNP:369384125
complement(846)-t, cdbSNP:200306803
complement(850)-t, cdbSNP:142557433
complement(941)-dbSNP:
complement(941)-t, cdbSNP:144417417
complement(945)-g, adbSNP:140495297
complement(947)-g, adbSNP:202001996
complement(1001)-g, adbSNP:147230681
complement(1034)-dbSNP:
complement(1034)-c, adbSNP:201032266
complement(1070)-c, adbSNP:373940127
complement(1098)-t, cdbSNP:143717863
complement(1117)-g, adbSNP:148473288
complement(1161)-g, cdbSNP:370443310
complement(1172)-g, adbSNP:144455343
complement(1173)-t, cdbSNP:149233372
complement(1187)-t, cdbSNP:200482028
complement(1196)-t, cdbSNP:368420610
complement(1232)-t, cdbSNP:377234774
complement(1267)-dbSNP:
complement(1267)-t, cdbSNP:138467082
complement(1279)-g, adbSNP:201335788
complement(1282)-c, adbSNP:200293412
complement(1291)-g, adbSNP:368949581
complement(1301)-g, adbSNP:371758548
complement(1302)-c, adbSNP:373722325
complement(1313)-g, adbSNP:202012198
1314+a, gdbSNP:57521499
complement(1323)-g, adbSNP:367908162
complement(1342)-t, cdbSNP:374057186
complement(1352)-t, cdbSNP:371064001
complement(1377)-c, adbSNP:376707935
complement(1379)-g, adbSNP:144665669
complement(1396)-g, adbSNP:200356238
complement(1402)-g, adbSNP:143008010
complement(1403)-t, cdbSNP:138399575
complement(1433)-g, cdbSNP:145913608
complement(1441)-g, adbSNP:369942106
complement(1442)-t, cdbSNP:200879771
1451+c, tdbSNP:11084940
complement(1452)-t, cdbSNP:377691705
complement(1479)-t, cdbSNP:187964885
complement(1570)-dbSNP:
complement(1570)-t, cdbSNP:151318750
complement(1588)-g, adbSNP:368745985
complement(1589)-g, cdbSNP:11882908
complement(1602)-g, adbSNP:373654310
complement(1604)-t, cdbSNP:375419899
complement(1605)-g, adbSNP:201055797
complement(1610)-g, adbSNP:140216957
complement(1641)-dbSNP:
complement(1641)-t, cdbSNP:368160143
1660+c, tdbSNP:1978725
complement(1664)-g, adbSNP:149126950
complement(1667)-t, cdbSNP:147703402
complement(1702)-g, adbSNP:374358274
complement(1712)-g, cdbSNP:369838129
complement(1717)-c, adbSNP:145444042
complement(1721)-g, adbSNP:140533741
complement(1722)-t, cdbSNP:201618968
complement(1728)-g, cdbSNP:377753934
complement(1733)-g, adbSNP:147619532
complement(1742)-g, adbSNP:372581793
complement(1743)-t, cdbSNP:149924406
complement(1751)-dbSNP:
complement(1751)-t, cdbSNP:139202712
complement(1772)-g, cdbSNP:150787379
complement(1777)-g, adbSNP:147230168
complement(1778)-g, cdbSNP:142082911
complement(1784)-c, adbSNP:139812127
complement(1785)-g, adbSNP:201873197
complement(1786)-t, cdbSNP:377036714
complement(1797)-t, cdbSNP:372679182
complement(1800)-t, cdbSNP:369186977
complement(1812)-g, cdbSNP:375038177
complement(1831)-t, cdbSNP:145978406
complement(1889)-dbSNP:
complement(1889)-g, adbSNP:377605893
complement(1900)-t, gdbSNP:142439833
complement(1909)-g, cdbSNP:371773627
complement(1942)-g, adbSNP:199897691
complement(2025)-g, cdbSNP:373147642
2160+c, tdbSNP:144691121
complement(2169)-g, cdbSNP:183700524
2170+c, gdbSNP:1049910
complement(2227)-t, cdbSNP:181735028
complement(2277)-t, gdbSNP:149341537
complement(2339)-g, adbSNP:376060464
2383+c, tdbSNP:138897905
complement(2410)-g, adbSNP:377192792
complement(2436)-t, c, adbSNP:189361311
2552+a, cdbSNP:75202524
complement(2575)-t, cdbSNP:743578
complement(2686)-, gdbSNP:200429328
complement(2825)-t, cdbSNP:375513770
complement(2849..2850)-, adbSNP:201799670
complement(2900)-g, cdbSNP:185851026
complement(3113)-t, cdbSNP:192858127
complement(3192)-t, cdbSNP:190368272
complement(3197)-g, adbSNP:371882770
complement(3272)-g, adbSNP:58852705
complement(3408)-t, cdbSNP:116370116
complement(3420)-g, adbSNP:140604670
complement(3424)-t, cdbSNP:148368930
3426+c, gdbSNP:1049912
3482+c, gdbSNP:1049913
complement(3499)-g, cdbSNP:143452400
3526+a, gdbSNP:1049914
3569+c, gdbSNP:1049915
3698+a, gdbSNP:1049916
complement(3711)-t, cdbSNP:148818996
3758+a, cdbSNP:1049917
complement(3870..3871)-, gdbSNP:372159429
complement(3899)-c, adbSNP:372589275
3941+c, gdbSNP:1049918
3944+c, gdbSNP:1049919
3962+a, cdbSNP:1049922
3973+a, cdbSNP:1049923
4008+c, gdbSNP:1049924
complement(4100)-g, adbSNP:184609927
complement(4164)-g, adbSNP:372255864
complement(4186)-, gdbSNP:35146837
complement(4262)-g, adbSNP:368027066
complement(4298)-c, adbSNP:375786190
complement(4338)-g, adbSNP:11542333
4414+c, gdbSNP:3209976
complement(4463..4464)-, gdbSNP:368092568
4554+c, tdbSNP:1050009
complement(4560..4561)-, adbSNP:397859894
complement(4570..4571)-, a, aadbSNP:35520147
complement(4570)-g, adbSNP:191850831
complement(4571)-g, adbSNP:76278622
Gene SymbolLMNB2
Gene SynonymLAMB2; LMN2
Chromosome19
Locus Map19p13.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_032737 Homo sapiens lamin B2 (LMNB2), mRNA. On-demand TBD TBD
Title Disruption of lamin B1 and lamin B2 processing and localization by farnesyltransferase inhibitors .
Author Adam SA, Butin-Israeli V, Cleland MM, Shimi T and Goldman RD.
Journal Nucleus 4 (2), 142-150 (2013)
Title A Chinese patient with acquired partial lipodystrophy caused by a novel mutation with LMNB2 gene .
Author Gao J, Li Y, Fu X and Luo X.
Journal J. Pediatr. Endocrinol. Metab. 25 (3-4), 375-377 (2012)
Title Laminopathies and lamin-associated signaling pathways .
Author Maraldi NM, Capanni C, Cenni V, Fini M and Lattanzi G.
Journal J. Cell. Biochem. 112 (4), 979-992 (2011)
Title Characterization of the head-to-tail overlap complexes formed by human lamin A, B1 and B2 'half-minilamin' dimers .
Author Kapinos LE, Schumacher J, Mucke N, Machaidze G, Burkhard P, Aebi U, Strelkov SV and Herrmann H.
Journal J. Mol. Biol. 396 (3), 719-731 (2010)
Title Identification of a novel, highly variable amino-terminal amino acid sequence element in the nuclear intermediate filament protein lamin B(2) from higher vertebrates .
Author Schumacher J, Reichenzeller M, Kempf T, Schnolzer M and Herrmann H.
Journal FEBS Lett. 580 (26), 6211-6216 (2006)
Title The gene for a novel human lamin maps at a highly transcribed locus of chromosome 19 which replicates at the onset of S-phase .
Author Biamonti G, Giacca M, Perini G, Contreas G, Zentilin L, Weighardt F, Guerra M, Della Valle G, Saccone S and Riva S.
Journal Mol. Cell. Biol. 12 (8), 3499-3506 (1992)
Title A human DNA replication origin: localization and transcriptional characterization .
Author Biamonti G, Perini G, Weighardt F, Riva S, Giacca M, Norio P, Zentilin L, Diviacco S, Dimitrova D and Falaschi A.
Journal Chromosoma 102 (1 SUPPL), S24-S31 (1992)
Title Identification of lamin B2 as a substrate of protein kinase C in BALB/MK-2 mouse keratinocytes .
Author Kasahara K, Chida K, Tsunenaga M, Kohno Y, Ikuta T and Kuroki T.
Journal J. Biol. Chem. 266 (30), 20018-20023 (1991)
Title Functional characterization of Tat protein from human immunodeficiency virus. Evidence that Tat links viral RNAs to nuclear matrix .
Author Muller WE, Okamoto T, Reuter P, Ugarkovic D and Schroder HC.
Journal J. Biol. Chem. 265 (7), 3803-3808 (1990)
Title [Vulvar neoplasms and preoperative lymphography] .
Author Bender,H.G., Werner,C., Greuel,H. and Timp,P.
Journal Fortschr. Med. 95 (44), 2645-2652 (1977)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.