• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant E, mRNA.


RefSeq Accession Definition Services Price Order
NM_033164 Homo sapiens fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant E, mRNA. ORF Sequence $203.58
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_033164.3, 298919214
Length 1003 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant E, mRNA.
Product fibroblast growth factor 8 isoform E precursor
Comment

Summary: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (E) uses an alternate splice site, compared to variant F. The encoded isoform (E) is shorter than isoform F.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_149354.1
CDS 103..804
Misc Feature(1)316..690
Misc Feature(2)order(316..318,325..327,421..423,427..429,433..435,
Misc Feature(3)order(616..621,634..636,646..648,664..666)
Exon (1)1..134
Gene:FGF8
Gene Synonym:AIGF; FGF-8; HBGF-8; HH6; KAL6
Exon (2)135..171
Gene:FGF8
Gene Synonym:AIGF; FGF-8; HBGF-8; HH6; KAL6
Exon (3)172..258
Gene:FGF8
Gene Synonym:AIGF; FGF-8; HBGF-8; HH6; KAL6
Exon (4)259..406
Gene:FGF8
Gene Synonym:AIGF; FGF-8; HBGF-8; HH6; KAL6
Exon (5)407..513
Gene:FGF8
Gene Synonym:AIGF; FGF-8; HBGF-8; HH6; KAL6
Exon (6)514..1003
Gene:FGF8
Gene Synonym:AIGF; FGF-8; HBGF-8; HH6; KAL6
Translation MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLV TDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGA ETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKG SKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(31)-t, cdbSNP:150146213
complement(39)-c, adbSNP:2735432
complement(142)-c, adbSNP:137852659
complement(179)-dbSNP:
complement(179)-t, cdbSNP:137852660
complement(186)-c, adbSNP:199858724
complement(220)-t, cdbSNP:137852661
complement(292)-dbSNP:
complement(292)-g, adbSNP:184500788
complement(367)-g, adbSNP:137852662
complement(381)-g, adbSNP:144275045
complement(414)-dbSNP:
complement(414)-g, adbSNP:112137472
complement(429)-g, adbSNP:146812350
complement(447)-t, cdbSNP:1048331
complement(448)-g, cdbSNP:137852663
complement(467)-g, cdbSNP:61730334
complement(468)-t, cdbSNP:150019367
complement(492)-t, cdbSNP:201793069
complement(538)-dbSNP:
complement(538)-t, cdbSNP:139565972
complement(545)-g, adbSNP:150575389
complement(546)-t, cdbSNP:141763609
complement(595)-t, cdbSNP:201979353
complement(629)-t, cdbSNP:138208879
complement(651)-t, cdbSNP:147342890
complement(711)-g, adbSNP:116363564
complement(724)-g, adbSNP:138682882
complement(755)-t, cdbSNP:137852664
complement(792)-g, cdbSNP:1071634
complement(841)-t, gdbSNP:150912902
complement(928)-g, cdbSNP:3218239
complement(934)-g, cdbSNP:77611428
complement(969)-, t, tttttdbSNP:71016346
complement(991)-, adbSNP:11322844
Gene SymbolFGF8
Gene SynonymAIGF; FGF-8; HBGF-8; HH6; KAL6
Chromosome10
Locus Map10q24
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_001206389 Homo sapiens fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant G, mRNA. Full Length $248.24
ORF Sequence $159.00
NM_006119 Homo sapiens fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant B, mRNA. Full Length $275.21
ORF Sequence $187.92
NM_033163 Homo sapiens fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant F, mRNA. Full Length $300.44
ORF Sequence $213.15
NM_033164 Homo sapiens fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant E, mRNA. Full Length $290.87
ORF Sequence $203.58
NM_033165 Homo sapiens fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant A, mRNA. Full Length $265.64
ORF Sequence $178.35
Title Fibroblast growth factor 8b causes progressive stromal and epithelial changes in the epididymis and degeneration of the seminiferous epithelium in the testis of transgenic mice .
Author Elo,T., Sipila,P., Valve,E., Kujala,P., Toppari,J., Poutanen,M. and Harkonen,P.
Journal Biol. Reprod. 86 (5), 157 (2012)
Title Genetic overlap in Kallmann syndrome, combined pituitary hormone deficiency, and septo-optic dysplasia .
Author Raivio,T., Avbelj,M., McCabe,M.J., Romero,C.J., Dwyer,A.A., Tommiska,J., Sykiotis,G.P., Gregory,L.C., Diaczok,D., Tziaferi,V., Elting,M.W., Padidela,R., Plummer,L., Martin,C., Feng,B., Zhang,C., Zhou,Q.Y., Chen,H., Mohammadi,M., Quinton,R., Sidis,Y., Radovick,S., Dattani,M.T. and Pitteloud,N.
Journal J. Clin. Endocrinol. Metab. 97 (4), E694-E699 (2012)
Title Differential expression of FGF family members in a progestin-dependent BT-474 human breast cancer xenograft model .
Author Lopez Perez,F.R., Liang,Y., Besch-Williford,C.L., Mafuvadze,B. and Hyder,S.M.
Journal Histol. Histopathol. 27 (3), 337-345 (2012)
Title Genomic structure, sequence, and mapping of human FGF8 with no evidence for its role in craniosynostosis/limb defect syndromes .
Author Yoshiura,K., Leysens,N.J., Chang,J., Ward,D., Murray,J.C. and Muenke,M.
Journal Am. J. Med. Genet. 72 (3), 354-362 (1997)
Title Molecular cloning and characterization of human FGF8 alternative messenger RNA forms .
Author Ghosh,A.K., Shankar,D.B., Shackleford,G.M., Wu,K., T'Ang,A., Miller,G.J., Zheng,J. and Roy-Burman,P.
Journal Cell Growth Differ. 7 (10), 1425-1434 (1996)
Title The human FGF-8 gene localizes on chromosome 10q24 and is subjected to induction by androgen in breast cancer cells .
Author Payson,R.A., Wu,J., Liu,Y. and Chiu,I.M.
Journal Oncogene 13 (1), 47-53 (1996)
Title Structure and sequence of human FGF8 .
Author Gemel,J., Gorry,M., Ehrlich,G.D. and MacArthur,C.A.
Journal Genomics 35 (1), 253-257 (1996)
Title Receptor specificity of the fibroblast growth factor family .
Author Ornitz,D.M., Xu,J., Colvin,J.S., McEwen,D.G., MacArthur,C.A., Coulier,F., Gao,G. and Goldfarb,M.
Journal J. Biol. Chem. 271 (25), 15292-15297 (1996)
Title Assignment of FGF8 to human chromosome 10q25-q26: mutations in FGF8 may be responsible for some types of acrocephalosyndactyly linked to this region .
Author White,R.A., Dowler,L.L., Angeloni,S.V., Pasztor,L.M. and MacArthur,C.A.
Journal Genomics 30 (1), 109-111 (1995)
Title Human androgen-induced growth factor in prostate and breast cancer cells: its molecular cloning and growth properties .
Author Tanaka,A., Miyamoto,K., Matsuo,H., Matsumoto,K. and Yoshida,H.
Journal FEBS Lett. 363 (3), 226-230 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878