• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant E, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_033164 Homo sapiens fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant E, mRNA. GenEZ ORF Cloning On-demand $399.00 14

*Business Day

Related Services

RefSeq Version NM_033164.3, 298919214
Length 1003 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant E, mRNA.
Product fibroblast growth factor 8 isoform E precursor
Comment

Summary: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (E) uses an alternate splice site, compared to variant F. The encoded isoform (E) is shorter than isoform F.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_149354.1
CDS 103..804
Misc Feature(1)316..690
Misc Feature(2)order(316..318,325..327,421..423,427..429,433..435,
Misc Feature(3)order(616..621,634..636,646..648,664..666)
Exon (1)1..134
Gene:FGF8
Gene Synonym:AIGF; FGF-8; HBGF-8; HH6; KAL6
Exon (2)135..171
Gene:FGF8
Gene Synonym:AIGF; FGF-8; HBGF-8; HH6; KAL6
Exon (3)172..258
Gene:FGF8
Gene Synonym:AIGF; FGF-8; HBGF-8; HH6; KAL6
Exon (4)259..406
Gene:FGF8
Gene Synonym:AIGF; FGF-8; HBGF-8; HH6; KAL6
Exon (5)407..513
Gene:FGF8
Gene Synonym:AIGF; FGF-8; HBGF-8; HH6; KAL6
Exon (6)514..1003
Gene:FGF8
Gene Synonym:AIGF; FGF-8; HBGF-8; HH6; KAL6
Translation MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLV TDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGA ETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKG SKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(31)-t, cdbSNP:150146213
39+a, cdbSNP:2735432
142+a, cdbSNP:137852659
179+dbSNP:
179+c, tdbSNP:137852660
complement(186)-c, adbSNP:199858724
220+c, tdbSNP:137852661
complement(292)-dbSNP:
complement(292)-g, adbSNP:184500788
complement(316)-g, adbSNP:375117193
complement(333)-g, adbSNP:373255404
367+a, gdbSNP:137852662
complement(381)-g, adbSNP:144275045
complement(405)-t, gdbSNP:369110952
complement(414)-dbSNP:
complement(414)-g, adbSNP:112137472
complement(417)-g, adbSNP:367853216
complement(429)-g, adbSNP:146812350
447+c, tdbSNP:1048331
448+c, gdbSNP:137852663
complement(467)-g, cdbSNP:61730334
complement(468)-t, cdbSNP:150019367
complement(471)-t, gdbSNP:375321211
complement(492)-t, cdbSNP:201793069
complement(522)-dbSNP:
complement(522)-g, cdbSNP:369378136
complement(538)-t, cdbSNP:139565972
complement(545)-g, adbSNP:150575389
complement(546)-t, cdbSNP:141763609
complement(576)-t, cdbSNP:375849952
complement(577)-g, adbSNP:371534104
complement(595)-t, cdbSNP:201979353
complement(619)-g, adbSNP:369967262
complement(629)-t, cdbSNP:138208879
complement(635)-t, cdbSNP:377240055
complement(651)-t, cdbSNP:147342890
complement(687)-g, cdbSNP:376225463
complement(694)-g, adbSNP:367593833
complement(711)-g, adbSNP:116363564
complement(724)-g, adbSNP:138682882
755+c, tdbSNP:137852664
complement(757)-g, adbSNP:370899813
792+c, gdbSNP:1071634
complement(841)-t, gdbSNP:150912902
complement(871)-g, cdbSNP:370145856
928+c, gdbSNP:3218239
complement(934)-g, cdbSNP:77611428
969+, tdbSNP:71016346
complement(990..991)-, adbSNP:375847024
complement(991)-, adbSNP:11322844
Gene SymbolFGF8
Gene SynonymAIGF; FGF-8; HBGF-8; HH6; KAL6
Chromosome10
Locus Map10q24
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_033164 Homo sapiens fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant E, mRNA. On-demand $399.00 14
NM_033165 Homo sapiens fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant A, mRNA. In-stock $308.00 $259.00 10
NM_006119 Homo sapiens fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant B, mRNA. In-stock $308.00 $259.00 10
NM_001206389 Homo sapiens fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant G, mRNA. In-stock $248.00 $199.00 10
NM_033163 Homo sapiens fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant F, mRNA. In-stock $308.00 $259.00 10
Title Screening a phage display library for a novel FGF8b-binding peptide with anti-tumor effect on prostate cancer .
Author Wang W, Chen X, Li T, Li Y, Wang R, He D, Luo W, Li X and Wu X.
Journal Exp. Cell Res. 319 (8), 1156-1164 (2013)
Title Prioritizing genetic testing in patients with Kallmann syndrome using clinical phenotypes .
Author Costa-Barbosa FA, Balasubramanian R, Keefe KW, Shaw ND, Al-Tassan N, Plummer L, Dwyer AA, Buck CL, Choi JH, Seminara SB, Quinton R, Monies D, Meyer B, Hall JE, Pitteloud N and Crowley WF Jr.
Journal J. Clin. Endocrinol. Metab. 98 (5), E943-E953 (2013)
Title Genomic structure, sequence, and mapping of human FGF8 with no evidence for its role in craniosynostosis/limb defect syndromes .
Author Yoshiura K, Leysens NJ, Chang J, Ward D, Murray JC and Muenke M.
Journal Am. J. Med. Genet. 72 (3), 354-362 (1997)
Title Molecular cloning and characterization of human FGF8 alternative messenger RNA forms .
Author Ghosh AK, Shankar DB, Shackleford GM, Wu K, T'Ang A, Miller GJ, Zheng J and Roy-Burman P.
Journal Cell Growth Differ. 7 (10), 1425-1434 (1996)
Title The human FGF-8 gene localizes on chromosome 10q24 and is subjected to induction by androgen in breast cancer cells .
Author Payson RA, Wu J, Liu Y and Chiu IM.
Journal Oncogene 13 (1), 47-53 (1996)
Title Structure and sequence of human FGF8 .
Author Gemel J, Gorry M, Ehrlich GD and MacArthur CA.
Journal Genomics 35 (1), 253-257 (1996)
Title Receptor specificity of the fibroblast growth factor family .
Author Ornitz DM, Xu J, Colvin JS, McEwen DG, MacArthur CA, Coulier F, Gao
Journal J. Biol. Chem. 271 (25), 15292-15297 (1996)
Title Assignment of FGF8 to human chromosome 10q25-q26: mutations in FGF8 may be responsible for some types of acrocephalosyndactyly linked to this region .
Author White RA, Dowler LL, Angeloni SV, Pasztor LM and MacArthur CA.
Journal Genomics 30 (1), 109-111 (1995)
Title Human androgen-induced growth factor in prostate and breast cancer cells: its molecular cloning and growth properties .
Author Tanaka A, Miyamoto K, Matsuo H, Matsumoto K and Yoshida H.
Journal FEBS Lett. 363 (3), 226-230 (1995)
Title Isolated Gonadotropin-Releasing Hormone (GnRH) Deficiency .
Author Buck,C., Balasubramanian,R. and Crowley,W.F.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.