• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens promyelocytic leukemia (PML), transcript variant 5, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_033244 Homo sapiens promyelocytic leukemia (PML), transcript variant 5, mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_033244.3, 109637787
Length 3096 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens promyelocytic leukemia (PML), transcript variant 5, mRNA.
Product protein PML isoform 5
Comment

Summary: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (5) differs in the 3' UTR and the 3' coding region compared to variant 1. The resulting isoform (5, also known as PML-3B, PML-VI and TRIM19epsilon) contains a distinct C-terminus compared to isoform 1.

RefSeq NP_150247.2
CDS 141..1823
Misc Feature(1)162..164
Misc Feature(2)162..164
Misc Feature(3)222..224
Misc Feature(4)246..248
Misc Feature(5)252..254
Misc Feature(6)258..260
Misc Feature(7)264..266
Misc Feature(8)309..425
Misc Feature(9)order(309..311,318..320,354..356,360..362,369..371,
Misc Feature(10)333..335
Misc Feature(11)489..491
Misc Feature(12)510..638
Misc Feature(13)618..620
Misc Feature(14)858..1805
Misc Feature(15)1320..1325
Misc Feature(16)1347..1349
Misc Feature(17)1347..1349
Misc Feature(18)1365..1367
Misc Feature(19)1566..1610
Misc Feature(20)1599..1601
Misc Feature(21)1608..1610
Misc Feature(22)1608..1610
Misc Feature(23)1653..1655
Misc Feature(24)1653..1655
Misc Feature(25)1677..1679
Misc Feature(26)1692..1694
Misc Feature(27)1692..1694
Misc Feature(28)1719..1721
Misc Feature(29)1719..1721
Misc Feature(30)1728..1730
Misc Feature(31)1728..1730
Misc Feature(32)1743..1745
Misc Feature(33)1743..1745
Exon (1)1..269
Gene:PML
Gene Synonym:MYL; PP8675; RNF71; TRIM19
Exon (2)270..742
Gene:PML
Gene Synonym:MYL; PP8675; RNF71; TRIM19
Exon (3)743..1323
Gene:PML
Gene Synonym:MYL; PP8675; RNF71; TRIM19
Exon (4)1324..1394
Gene:PML
Gene Synonym:MYL; PP8675; RNF71; TRIM19
Exon (5)1395..1538
Gene:PML
Gene Synonym:MYL; PP8675; RNF71; TRIM19
Exon (6)1539..1805
Gene:PML
Gene Synonym:MYL; PP8675; RNF71; TRIM19
Exon (7)1806..1858
Gene:PML
Gene Synonym:MYL; PP8675; RNF71; TRIM19
Exon (8)1859..3081
Gene:PML
Gene Synonym:MYL; PP8675; RNF71; TRIM19
Translation MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQC QAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYR QIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDG TRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEEL DAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEA VDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLR QEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCS QTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLP NSNHVASGAGEAGRERNALW
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
44+dbSNP:
44+a, cdbSNP:181321458
73+a, gdbSNP:144576529
133..134+, gdbSNP:35863954
213+a, cdbSNP:376726233
222+a, cdbSNP:28504405
223+c, tdbSNP:201524800
283+dbSNP:
283+c, tdbSNP:377614337
306+c, tdbSNP:147696900
337..338+, cdbSNP:34228316
341+a, gdbSNP:374118853
375+c, gdbSNP:28412621
392+a, gdbSNP:369958078
456+a, gdbSNP:372639541
498+c, tdbSNP:141544943
514+c, gdbSNP:77069486
518+a, gdbSNP:376898295
527+c, tdbSNP:150904456
544+c, tdbSNP:372931853
602+a, gdbSNP:375933686
614+c, gdbSNP:370861713
617+c, tdbSNP:374283665
649+a, gdbSNP:200708179
662+a, gdbSNP:112099437
671+c, gdbSNP:368684793
695+c, gdbSNP:200143816
702+a, tdbSNP:373742710
709+c, tdbSNP:138345086
722+c, tdbSNP:367778787
727+a, cdbSNP:35291318
788+dbSNP:
788+a, gdbSNP:371576035
812+g, tdbSNP:17849258
893+a, tdbSNP:267604312
904..905+, gdbSNP:34681920
932+c, tdbSNP:17849259
952+c, tdbSNP:369316804
959+a, c, gdbSNP:112627818
1007+c, tdbSNP:375794405
1059+c, tdbSNP:140050477
1067+c, tdbSNP:143705203
1068+a, gdbSNP:146344435
1069+a, tdbSNP:377549937
1084+a, gdbSNP:139917470
1115+c, tdbSNP:142180894
1124+c, gdbSNP:151218142
1139+a, gdbSNP:138129034
1154+c, gdbSNP:371084483
1173+a, gdbSNP:199516006
1219+a, gdbSNP:375594567
1225+c, tdbSNP:74471420
1271+c, gdbSNP:377747936
1272+a, gdbSNP:371413149
1285+a, gdbSNP:149871195
1300+c, gdbSNP:369148720
1307+c, tdbSNP:147563445
1348+dbSNP:
1348+a, gdbSNP:142023780
1389+c, gdbSNP:145863996
1490+dbSNP:
1490+c, tdbSNP:138775462
1505+c, tdbSNP:376333996
complement(1506)-t, cdbSNP:11555843
1513+c, tdbSNP:143771296
1522+c, gdbSNP:148158604
1555+dbSNP:
1555+c, tdbSNP:200123201
1556+a, gdbSNP:142009914
1657+c, tdbSNP:202019975
1658+a, gdbSNP:377287687
1714+c, tdbSNP:370723883
1715+a, gdbSNP:375629289
1734+a, gdbSNP:146047180
1757+a, gdbSNP:138807296
1785+a, gdbSNP:11855663
1788+a, gdbSNP:374199653
1789+a, gdbSNP:146326362
1812+dbSNP:
1812+a, gdbSNP:200546578
1813+c, tdbSNP:139324287
1834+a, gdbSNP:147120400
1838+a, gdbSNP:375611361
1848+c, tdbSNP:371956504
1863+dbSNP:
1863+c, tdbSNP:149710270
1872+c, tdbSNP:370195590
1880+a, gdbSNP:144559886
1896+c, tdbSNP:372539605
1902+c, tdbSNP:78340702
1911+c, tdbSNP:374669015
1923+c, tdbSNP:147652568
1939+c, tdbSNP:141958169
1947+c, tdbSNP:373088243
1971+g, tdbSNP:199513809
1980+a, gdbSNP:144234369
2006+c, gdbSNP:201804134
2007..2008+, cdbSNP:140797024
2007+c, tdbSNP:369292960
2029+c, tdbSNP:201226688
2030+a, gdbSNP:112272650
2030+c, tdbSNP:386449354
2047+c, tdbSNP:369911359
2050+c, tdbSNP:140216915
2069+a, gdbSNP:200905984
2072+c, gdbSNP:200094687
2086+a, gdbSNP:202182247
2090+c, tdbSNP:200988291
2091+a, gdbSNP:377501404
2098+c, tdbSNP:150442989
2105+c, tdbSNP:138276205
2114+c, tdbSNP:371144013
2115+a, gdbSNP:149202279
2137+a, gdbSNP:377354460
2147+c, tdbSNP:145160033
2157+a, gdbSNP:139031068
2165+c, tdbSNP:75056290
2166+a, gdbSNP:145646904
2177+c, gdbSNP:368679910
2184+a, tdbSNP:148106218
2187+a, gdbSNP:141894268
2194+c, tdbSNP:150761242
2207+c, tdbSNP:200400610
2210+a, cdbSNP:139143471
2234+c, gdbSNP:369036000
2240+a, gdbSNP:369253046
2246+a, gdbSNP:148636537
2266+c, tdbSNP:147213990
2295+a, gdbSNP:140648301
2318+c, tdbSNP:377295816
2319+a, gdbSNP:144170102
2322+a, tdbSNP:145461366
2323+a, tdbSNP:201456778
2325+a, gdbSNP:148418079
2328+a, gdbSNP:200633780
2336+c, tdbSNP:115552704
2345+a, gdbSNP:377619576
2375+c, tdbSNP:369142690
2433+a, cdbSNP:190536709
2435+a, gdbSNP:142557214
2444+a, gdbSNP:150969738
2462+a, c, gdbSNP:743580
2470+c, tdbSNP:145127312
2471+a, cdbSNP:146867846
2487+a, g, tdbSNP:743581
2552+c, gdbSNP:743582
2595+c, tdbSNP:373658022
2599+a, cdbSNP:370009213
2614+a, gdbSNP:377715350
2617+c, tdbSNP:370446869
2622+a, gdbSNP:76608781
2682+c, tdbSNP:201691315
2683+c, tdbSNP:200958951
2684+c, gdbSNP:111658103
2688+c, tdbSNP:199725271
2713+c, tdbSNP:370389300
2719+a, c, tdbSNP:200028634
2735+g, tdbSNP:149573441
2772+a, gdbSNP:375250698
2782+c, tdbSNP:368406946
2798+c, gdbSNP:141224194
2800+g, tdbSNP:762592
2834+a, gdbSNP:188723955
2837+a, gdbSNP:370140201
2922+a, gdbSNP:9479
2925+c, tdbSNP:1051697
2980+c, tdbSNP:1051700
2993+c, tdbSNP:1051702
3003+c, tdbSNP:1051703
3080+c, tdbSNP:192800282
Gene SymbolPML
Gene SynonymMYL; PP8675; RNF71; TRIM19
Chromosome15
Locus Map15q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_033247 Homo sapiens promyelocytic leukemia (PML), transcript variant 8, mRNA. On-demand $699.00 18
NM_033250 Homo sapiens promyelocytic leukemia (PML), transcript variant 11, mRNA. On-demand TBD TBD
NM_033238 Homo sapiens promyelocytic leukemia (PML), transcript variant 1, mRNA. On-demand $899.00 20
NM_033244 Homo sapiens promyelocytic leukemia (PML), transcript variant 5, mRNA. On-demand $699.00 18
NM_002675 Homo sapiens promyelocytic leukemia (PML), transcript variant 6, mRNA. On-demand $849.00 20
NM_033240 Homo sapiens promyelocytic leukemia (PML), transcript variant 2, mRNA. On-demand $849.00 20
NM_033249 Homo sapiens promyelocytic leukemia (PML), transcript variant 10, mRNA. On-demand $849.00 20
NM_033246 Homo sapiens promyelocytic leukemia (PML), transcript variant 7, mRNA. On-demand $699.00 18
NM_033239 Homo sapiens promyelocytic leukemia (PML), transcript variant 9, mRNA. On-demand TBD TBD
Title The tumor suppressor gene DAPK2 is induced by the myeloid transcription factors PU.1 and C/EBPalpha during granulocytic differentiation but repressed by PML-RARalpha in APL .
Author Humbert M, Federzoni EA, Britschgi A, Schlafli AM, Valk PJ, Kaufmann T, Haferlach T, Behre G, Simon HU, Torbett BE, Fey MF and Tschan MP.
Journal J. Leukoc. Biol. 95 (1), 83-93 (2014)
Title PML overexpression inhibits proliferation and promotes the osteogenic differentiation of human mesenchymal stem cells .
Author Sun J, Fu S, Zhong W and Huang H.
Journal Oncol. Rep. 30 (6), 2785-2794 (2013)
Title Two overlapping regions within the N-terminal half of the herpes simplex virus 1 E3 ubiquitin ligase ICP0 facilitate the degradation and dissociation of PML and dissociation of Sp100 from ND10 .
Author Perusina Lanfranca M, Mostafa HH and Davido DJ.
Journal J. Virol. 87 (24), 13287-13296 (2013)
Title PML nuclear bodies and SATB1 are associated with HLA class I expression in EBV+ Hodgkin lymphoma .
Author Liu Y, van den Berg A, Veenstra R, Rutgers B, Nolte I, van Imhoff G, Visser L and Diepstra A.
Journal PLoS ONE 8 (8), E72930 (2013)
Title Proximity to PML nuclear bodies regulates HIV-1 latency in CD4+ T cells .
Author Lusic M, Marini B, Ali H, Lucic B, Luzzati R and Giacca M.
Journal Cell Host Microbe 13 (6), 665-677 (2013)
Title Alternative splicing of PML transcripts predicts coexpression of several carboxy-terminally different protein isoforms .
Author Fagioli M, Alcalay M, Pandolfi PP, Venturini L, Mencarelli A, Simeone A, Acampora D, Grignani F and Pelicci PG.
Journal Oncogene 7 (6), 1083-1091 (1992)
Title Molecular rearrangements of the MYL gene in acute promyelocytic leukemia (APL, M3) define a breakpoint cluster region as well as some molecular variants .
Author Tong JH, Dong S, Geng JP, Huang W, Wang ZY, Sun GL, Chen SJ, Chen Z, Larsen CJ and Berger R.
Journal Oncogene 7 (2), 311-316 (1992)
Title Characterization of a zinc finger gene disrupted by the t(15;17) in acute promyelocytic leukemia .
Author Goddard AD, Borrow J, Freemont PS and Solomon E.
Journal Science 254 (5036), 1371-1374 (1991)
Title Chromosomal translocation t(15;17) in human acute promyelocytic leukemia fuses RAR alpha with a novel putative transcription factor, PML .
Author Kakizuka A, Miller WH Jr, Umesono K, Warrell RP Jr, Frankel SR, Murty VV, Dmitrovsky E and Evans RM.
Journal Cell 66 (4), 663-674 (1991)
Title [The laboratory in programs for enteric infection control] .
Author Grados,O.B.
Journal Bol Oficina Sanit Panam 78 (4), 318-322 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.