• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens hexokinase 1 (HK1), transcript variant 2, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_033496 Homo sapiens hexokinase 1 (HK1), transcript variant 2, mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_033496.2, 188497748
Length 3614 bp
Structure linear
Update Date 12-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens hexokinase 1 (HK1), transcript variant 2, mRNA.
Product hexokinase-1 isoform HKI-R
Comment

Summary: Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in five transcript variants which encode different isoforms, some of which are tissue-specific. Each isoform has a distinct N-terminus; the remainder of the protein is identical among all the isoforms. A sixth transcript variant has been described, but due to the presence of several stop codons, it is not thought to encode a protein. [provided by RefSeq, Apr 2009].


Transcript Variant: Variant 2 (HKI-R) encodes the erythroid-specific isoform. Isoform HKI-R lacks the porin binding domain (PBD), which mediates association with the mitochondrial membrane, and thus localizes to the cytoplasm. Variant 2 includes an erythroid-specific exon in the 5' end which encodes a distinct N-terminus.

RefSeq NP_277031.1
CDS 102..2852
Misc Feature(1)75..77
Misc Feature(2)162..1478
Misc Feature(3)162..1478
Misc Feature(4)339..884
Misc Feature(5)order(348..359,363..365,369..371,723..725,783..794)
Misc Feature(6)765..1478
Misc Feature(7)1482..2819
Misc Feature(8)1683..>2174
Misc Feature(9)order(1692..1703,1707..1709,1713..1715,2067..2069,
Misc Feature(10)2112..2819
Exon (1)1..161
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Exon (2)162..324
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Exon (3)325..473
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Exon (4)474..593
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Exon (5)594..689
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Exon (6)690..789
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Exon (7)790..973
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Exon (8)974..1129
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Exon (9)1130..1363
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Exon (10)1364..1668
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Exon (11)1669..1817
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Exon (12)1818..1937
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Exon (13)1938..2033
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Exon (14)2034..2133
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Exon (15)2134..2317
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Exon (16)2318..2473
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Exon (17)2474..2707
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Exon (18)2708..3599
Gene:HK1
Gene Synonym:HK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Translation MDCEHSLSLPCRGAEAWEIGIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATV KMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHG SGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVE GADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYMEE LRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMY LGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLGV EPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHP QYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLTK DMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVL LVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFT FSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGT MMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDDI RTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGI FETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAV VDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGA ALITAVGVRLRTEASS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
69+dbSNP:
69+g, tdbSNP:77682879
76+a, gdbSNP:377003198
100+a, cdbSNP:370279417
101+a, gdbSNP:151233119
138+g, tdbSNP:201670785
139+a, gdbSNP:374788115
142+c, tdbSNP:184545682
176+dbSNP:
176+c, gdbSNP:1133189
182+c, tdbSNP:201893778
194+c, tdbSNP:149919826
195+a, gdbSNP:375425117
206+a, cdbSNP:368609682
270+a, cdbSNP:77614723
282+a, gdbSNP:372315642
296+a, tdbSNP:34410083
394+dbSNP:
394+a, gdbSNP:201072105
470+c, tdbSNP:200234561
578+dbSNP:
578+a, gdbSNP:2228284
590+c, tdbSNP:375152115
629+dbSNP:
629+a, gdbSNP:370998274
632+c, tdbSNP:145719365
679+a, gdbSNP:190318420
687+c, gdbSNP:138198944
707+dbSNP:
707+c, tdbSNP:371974878
716+g, tdbSNP:141258173
757+a, gdbSNP:111978217
758+c, tdbSNP:191140928
786+a, gdbSNP:375278763
851+dbSNP:
851+c, tdbSNP:143391625
896+c, tdbSNP:35378602
926+a, gdbSNP:41279658
1038+dbSNP:
1038+a, gdbSNP:200379909
1047+a, gdbSNP:202028638
1056+c, tdbSNP:141581723
1076+g, tdbSNP:150869156
1098+c, tdbSNP:189866037
1113+a, gdbSNP:138492927
1127+a, cdbSNP:185200014
1170+dbSNP:
1170+c, tdbSNP:147132442
1203+a, gdbSNP:143502069
1208+a, gdbSNP:147176188
1250+c, tdbSNP:374591130
1272+a, gdbSNP:140290094
1290+a, cdbSNP:142724189
1325+a, gdbSNP:367932087
1355+a, gdbSNP:144445980
1412+dbSNP:
1412+c, tdbSNP:199988774
1419+c, tdbSNP:148472311
1433+a, gdbSNP:376133658
1445+c, tdbSNP:142710265
1475+g, tdbSNP:150977497
1490+c, gdbSNP:192297958
1506+a, gdbSNP:139936974
1508+a, gdbSNP:369549284
1524+c, tdbSNP:113893857
1531+a, gdbSNP:144282713
1541+a, gdbSNP:748235
1572+c, tdbSNP:373626952
1577+c, tdbSNP:141299323
1613+c, tdbSNP:140498607
1620+a, gdbSNP:145718031
1630+c, tdbSNP:375297844
1643+c, tdbSNP:61751207
1658+c, tdbSNP:200419488
1661+c, tdbSNP:145919021
1684+dbSNP:
1684+c, tdbSNP:137853249
1697+c, tdbSNP:369881116
1713+c, tdbSNP:200042335
1778+c, tdbSNP:199870318
1884+dbSNP:
1884+a, tdbSNP:370985073
1901+a, gdbSNP:200291189
1925+a, gdbSNP:148999865
1934+c, tdbSNP:143834023
1955+dbSNP:
1955+a, gdbSNP:138467910
1979+c, gdbSNP:374806058
1982+c, tdbSNP:201425600
1992+a, gdbSNP:367984091
2018+a, gdbSNP:144039188
2045+dbSNP:
2045+a, gdbSNP:372257811
2048+c, tdbSNP:375513461
2081+c, tdbSNP:374291625
2105+a, gdbSNP:117797901
2137+dbSNP:
2137+c, gdbSNP:398122379
2138+c, tdbSNP:2229387
2162+a, gdbSNP:374800288
2257+a, gdbSNP:369170269
2273+c, tdbSNP:138698348
2274..2275+, adbSNP:34747241
2286+a, gdbSNP:1054202
2324+dbSNP:
2324+a, gdbSNP:141211718
2327+a, gdbSNP:376319787
2424+a, cdbSNP:1054203
2437+a, gdbSNP:200751311
2463+c, gdbSNP:113021525
2468+a, c, tdbSNP:150711083
2537+dbSNP:
2537+c, tdbSNP:139053083
2552+c, tdbSNP:149531762
2564+g, tdbSNP:144185641
2567..2568+, gdbSNP:34015903
2567+c, tdbSNP:201668805
2595+c, gdbSNP:139917475
2617+c, tdbSNP:373871387
2634+c, tdbSNP:146727978
2635+a, gdbSNP:372212480
2636+c, tdbSNP:10998760
2639+g, tdbSNP:61751208
2647+a, gdbSNP:368303763
2652+a, gdbSNP:142362924
2681+c, tdbSNP:145610109
2711+dbSNP:
2711+c, tdbSNP:34616021
2731+c, tdbSNP:150481224
2732+a, gdbSNP:371194258
2756+c, tdbSNP:147758343
2789+c, tdbSNP:14006
2804+c, gdbSNP:201076725
2822+c, tdbSNP:375284444
2858+c, tdbSNP:13139
2859+a, gdbSNP:375340341
2874+c, gdbSNP:3750793
2877+c, tdbSNP:374328237
2902+c, tdbSNP:200311919
2910+c, gdbSNP:182986436
2932+g, tdbSNP:12751
2965+a, cdbSNP:372523358
2990+a, gdbSNP:369141486
3020+c, tdbSNP:116971854
3048+a, gdbSNP:115165850
complement(3073)-g, adbSNP:11556966
3120+g, tdbSNP:146521595
3136+c, tdbSNP:369926762
3181+a, tdbSNP:14382
3233+c, tdbSNP:372939029
3236+c, tdbSNP:187241214
3242+c, tdbSNP:12216
3276+a, gdbSNP:41279664
3449+g, tdbSNP:1803712
3456+c, gdbSNP:370842962
3458+c, gdbSNP:190145407
3478+a, gdbSNP:112135075
3499+c, tdbSNP:5030886
3551+c, gdbSNP:138566183
Gene SymbolHK1
Gene SynonymHK1-ta; HK1-tb; HK1-tc; HKD; HKI; HMSNR; HXK1
Chromosome10
Locus Map10q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_033496 Homo sapiens hexokinase 1 (HK1), transcript variant 2, mRNA. On-demand TBD TBD
NM_033497 Homo sapiens hexokinase 1 (HK1), transcript variant 3, mRNA. On-demand TBD TBD
NM_033498 Homo sapiens hexokinase 1 (HK1), transcript variant 4, mRNA. On-demand TBD TBD
NM_000188 Homo sapiens hexokinase 1 (HK1), transcript variant 1, mRNA. On-demand TBD TBD
NM_033500 Homo sapiens hexokinase 1 (HK1), transcript variant 5, mRNA. On-demand TBD TBD
XM_005269735 PREDICTED: Homo sapiens hexokinase 1 (HK1), transcript variant X1, mRNA. On-demand TBD TBD
XM_005269736 PREDICTED: Homo sapiens hexokinase 1 (HK1), transcript variant X2, mRNA. On-demand TBD TBD
XM_005269737 PREDICTED: Homo sapiens hexokinase 1 (HK1), transcript variant X3, mRNA. On-demand TBD TBD
Title Identification of HKDC1 and BACE2 as genes influencing glycemic traits during pregnancy through genome-wide association studies .
Author Hayes MG, Urbanek M, Hivert MF, Armstrong LL, Morrison J, Guo C, Lowe LP, Scheftner DA, Pluzhnikov A, Levine DM, McHugh CP, Ackerman CM, Bouchard L, Brisson D, Layden BT, Mirel D, Doheny KF, Leya MV, Lown-Hecht RN, Dyer AR, Metzger BE, Reddy TE, Cox NJ and Lowe WL Jr.
Journal Diabetes 62 (9), 3282-3291 (2013)
Title Keratin 8/18 regulation of glucose metabolism in normal versus cancerous hepatic cells through differential modulation of hexokinase status and insulin signaling .
Author Mathew J, Loranger A, Gilbert S, Faure R and Marceau N.
Journal Exp. Cell Res. 319 (4), 474-486 (2013)
Title Dominant form of congenital hyperinsulinism maps to HK1 region on 10q .
Author Pinney SE, Ganapathy K, Bradfield J, Stokes D, Sasson A, Mackiewicz K, Boodhansingh K, Hughes N, Becker S, Givler S, Macmullen C, Monos D, Ganguly A, Hakonarson H and Stanley CA.
Journal Horm Res Paediatr 80 (1), 18-27 (2013)
Title Seventy-five genetic loci influencing the human red blood cell .
Author van der Harst P, Zhang W, Mateo Leach I, Rendon A, Verweij N, Sehmi J, Paul DS, Elling U, Allayee H, Li X, Radhakrishnan A, Tan ST, Voss K, Weichenberger CX, Albers CA, Al-Hussani A, Asselbergs FW, Ciullo M, Danjou F, Dina C, Esko T, Evans DM, Franke L, Gogele M, Hartiala J, Hersch M, Holm H, Hottenga JJ, Kanoni S, Kleber ME, Lagou V, Langenberg C, Lopez LM, Lyytikainen LP, Melander O, Murgia F, Nolte IM, O'Reilly PF, Padmanabhan S, Parsa A, Pirastu N, Porcu E, Portas L, Prokopenko I, Ried JS, Shin SY, Tang CS, Teumer A, Traglia M, Ulivi S, Westra HJ, Yang J, Zhao JH, Anni F, Abdellaoui A, Attwood A, Balkau B, Bandinelli S, Bastardot F, Benyamin B, Boehm BO, Cookson WO, Das D, de Bakker PI, de Boer RA, de Geus EJ, de Moor MH, Dimitriou M, Domingues FS, Doring A, Engstrom G, Eyjolfsson GI, Ferrucci L, Fischer K, Galanello R, Garner SF, Genser B, Gibson QD, Girotto G, Gudbjartsson DF, Harris SE, Hartikainen AL, Hastie CE, Hedblad B, Illig T, Jolley J, Kahonen M, Kema IP, Kemp JP, Liang L, Lloyd-Jones H, Loos RJ, Meacham S, Medland SE, Meisinger C, Memari Y, Mihailov E, Miller K, Moffatt MF, Nauck M, Novatchkova M, Nutile T, Olafsson I, Onundarson PT, Parracciani D, Penninx BW, Perseu L, Piga A, Pistis G, Pouta A, Puc U, Raitakari O, Ring SM, Robino A, Ruggiero D, Ruokonen A, Saint-Pierre A, Sala C, Salumets A, Sambrook J, Schepers H, Schmidt CO, Sillje HH, Sladek R, Smit JH, Starr JM, Stephens J, Sulem P, Tanaka T, Thorsteinsdottir U, Tragante V, van Gilst WH, van Pelt LJ, van Veldhuisen DJ, Volker U, Whitfield JB, Willemsen G, Winkelmann BR, Wirnsberger G, Algra A, Cucca F, d'Adamo AP, Danesh J, Deary IJ, Dominiczak AF, Elliott P, Fortina P, Froguel P, Gasparini P, Greinacher A, Hazen SL, Jarvelin MR, Khaw KT, Lehtimaki T, Maerz W, Martin NG, Metspalu A, Mitchell BD, Montgomery GW, Moore C, Navis G, Pirastu M, Pramstaller PP, Ramirez-Solis R, Schadt E, Scott J, Shuldiner AR, Smith GD, Smith JG, Snieder H, Sorice R, Spector TD, Stefansson K, Stumvoll M, Tang WH, Toniolo D, Tonjes A, Visscher PM, Vollenweider P, Wareham NJ, Wolffenbuttel BH, Boomsma DI, Beckmann JS, Dedoussis GV, Deloukas P, Ferreira MA, Sanna S, Uda M, Hicks AA, Penninger JM, Gieger C, Kooner JS, Ouwehand WH, Soranzo N and Chambers JC.
Journal Nature 492 (7429), 369-375 (2012)
Title Mitochondrial hexokinase HKI is a novel substrate of the Parkin ubiquitin ligase .
Author Okatsu K, Iemura S, Koyano F, Go E, Kimura M, Natsume T, Tanaka K and Matsuda N.
Journal Biochem. Biophys. Res. Commun. 428 (1), 197-202 (2012)
Title A recombinant human 'mini'-hexokinase is catalytically active and regulated by hexose 6-phosphates .
Author Magnani M, Bianchi M, Casabianca A, Stocchi V, Daniele A, Altruda F, Ferrone M and Silengo L.
Journal Biochem. J. 285 (PT 1), 193-199 (1992)
Title Mapping of human hexokinase 1 gene to 10q11----qter .
Author Daniele A, Altruda F, Ferrone M, Silengo L, Romeo G, Archidiacono N and Rocchi M.
Journal Hum. Hered. 42 (2), 107-110 (1992)
Title Protein kinase activity of rat brain hexokinase .
Author Adams V, Griffin LD, Gelb BD and McCabe ER.
Journal Biochem. Biophys. Res. Commun. 177 (3), 1101-1106 (1991)
Title Human hexokinase type I microheterogeneity is due to different amino-terminal sequences .
Author Magnani M, Serafini G, Bianchi M, Casabianca A and Stocchi V.
Journal J. Biol. Chem. 266 (1), 502-505 (1991)
Title An isozyme of hexokinase specific for the human red blood cell (HKR) .
Author Murakami K, Blei F, Tilton W, Seaman C and Piomelli S.
Journal Blood 75 (3), 770-775 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.