• THAT   AND
  • THAT   AND


Rattus norvegicus cholinergic receptor, nicotinic, beta 4 (Chrnb4), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_052806 Rattus norvegicus cholinergic receptor, nicotinic, beta 4 (Chrnb4), mRNA. Full Lenth $431.52
ORF Sequence $431.52
RefSeq Version NM_052806.2, 148747284
Length 1488 bp
Structure linear
Update Date 10-APR-2011
Organism Rattus norvegicus (Norway rat)
Definition Rattus norvegicus cholinergic receptor, nicotinic, beta 4 (Chrnb4), mRNA.
Product neuronal acetylcholine receptor subunit beta-4 precursor
Comment

Summary: may act as a subunit of a neuronal nicotinic acetylcholine receptor [RGD].

RefSeq NP_434693.1
CDS 1..1488
Translation MRGTPLLLVSLFSLLQDGDCRLANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIRLELS LSQLISVNEREQIMTTSIWLKQEWTDYRLAWNSSCYEGVNILRIPAKRVWLPDIVLYNNA DGTYEVSVYTNVIVRSNGSIQWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEI DMVLKSPTAIMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLII PCVLITSLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDIPLIGKYLLF TMVLVTFSIVTTVCVLNVHHRSPSTHTMASWVKECFLHKLPTFLFMKRPGLEVSLVRVPH PSQLHLATADTAATSALGPTSPSNLYGSSMYFVNPVPAAPKSAVSSHTAGLPRDARLRSS GRFREDLQEALEGVSFIAQHLESDDRDQSVIEDWKFVAMVVDRLFLWVFVFVCILGTMGL FLPPLFQIHAPSKDS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolChrnb4
Gene SynonymChrnb4
Chromosome8
Locus Map8q24
All Transcripts NM_052806
Title Role of loop 9 on the function of neuronal nicotinic receptors .
Author Criado,M., Castillo,M., Mulet,J., Sala,F. and Sala,S.
Journal Biochim. Biophys. Acta 1798 (3), 654-659 (2010)
Title An extracellular protein microdomain controls up-regulation of neuronal nicotinic acetylcholine receptors by nicotine .
Author Sallette,J., Bohler,S., Benoit,P., Soudant,M., Pons,S., Le Novere,N., Changeux,J.P. and Corringer,P.J.
Journal J. Biol. Chem. 279 (18), 18767-18775 (2004)
Title High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence .
Author Kwitek,A.E., Gullings-Handley,J., Yu,J., Carlos,D.C., Orlebeke,K., Nie,J., Eckert,J., Lemke,A., Andrae,J.W., Bromberg,S., Pasko,D., Chen,D., Scheetz,T.E., Casavant,T.L., Soares,M.B., Sheffield,V.C., Tonellato,P.J. and Jacob,H.J.
Journal Genome Res. 14 (4), 750-757 (2004)
Title Molecular biology and electrophysiology of neuronal nicotinic receptors of rat chromaffin cells .
Author Di Angelantonio,S., Matteoni,C., Fabbretti,E. and Nistri,A.
Journal Eur. J. Neurosci. 17 (11), 2313-2322 (2003)
Title Formation of oligomers containing the beta3 and beta4 subunits of the rat nicotinic receptor .
Author Forsayeth,J.R. and Kobrin,E.
Journal J. Neurosci. 17 (5), 1531-1538 (1997)
Title Alpha 3, alpha 5, and beta 4: three members of the rat neuronal nicotinic acetylcholine receptor-related gene family form a gene cluster .
Author Boulter,J., O'Shea-Greenfield,A., Duvoisin,R.M., Connolly,J.G., Wada,E., Jensen,A., Gardner,P.D., Ballivet,M., Deneris,E.S., McKinnon,D. et al.
Journal J. Biol. Chem. 265 (8), 4472-4482 (1990)
Title The functional diversity of the neuronal nicotinic acetylcholine receptors is increased by a novel subunit: beta 4 .
Author Duvoisin,R.M., Deneris,E.S., Patrick,J. and Heinemann,S.
Journal Neuron 3 (4), 487-496 (1989)
Title Cloning of a putative neuronal nicotinic acetylcholine receptor subunit .
Author Isenberg,K.E. and Meyer,G.E.
Journal J. Neurochem. 52 (3), 988-991 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878