• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens caspase recruitment domain family, member 14 (CARD14), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu10658 Homo sapiens caspase recruitment domain family, member 14 (CARD14), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu10658C Homo sapiens caspase recruitment domain family, member 14 (CARD14), transcript variant 2, mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_052819.2, 332801088
Length 1305 bp
Structure linear
Update Date 16-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens caspase recruitment domain family, member 14 (CARD14), transcript variant 2, mRNA.
Product caspase recruitment domain-containing protein 14 isoform 2
Comment

Summary: This gene encodes a caspase recruitment domain-containing protein that is a member of the membrane-associated guanylate kinase (MAGUK) family of proteins. Members of this protein family are scaffold proteins that are involved in a diverse array of cellular processes including cellular adhesion, signal transduction and cell polarity control. This protein has been shown to specifically interact with BCL10, a protein known to function as a positive regulator of cell apoptosis and NF-kappaB activation. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2012].


Transcript Variant: This variant (2) lacks several exons at the 5' and 3' ends and its transcription extends past a splice site that is used in variant 1. The encoded isoform 2 has a shorter N-terminus and a distinct C-terminus, compared to isoform 1.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.


##Evidence-Data-START## Transcript exon combination :: BC001326.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_438170.1
CDS 161..1465
Misc Feature(1)98..100
Misc Feature(2)98..100
Misc Feature(3)<227..529
Misc Feature(4)<227..529
Misc Feature(5)350..655
Misc Feature(6)<482..676
Misc Feature(7)1196..>1303
Exon (1)1..124
Gene:CARD14
Gene Synonym:BIMP2; CARMA2; PRP; PSORS2; PSS1
Exon (2)125..292
Gene:CARD14
Gene Synonym:BIMP2; CARMA2; PRP; PSORS2; PSS1
Exon (3)293..412
Gene:CARD14
Gene Synonym:BIMP2; CARMA2; PRP; PSORS2; PSS1
Exon (4)413..538
Gene:CARD14
Gene Synonym:BIMP2; CARMA2; PRP; PSORS2; PSS1
Exon (5)539..688
Gene:CARD14
Gene Synonym:BIMP2; CARMA2; PRP; PSORS2; PSS1
Exon (6)689..805
Gene:CARD14
Gene Synonym:BIMP2; CARMA2; PRP; PSORS2; PSS1
Exon (7)806..948
Gene:CARD14
Gene Synonym:BIMP2; CARMA2; PRP; PSORS2; PSS1
Exon (8)949..1043
Gene:CARD14
Gene Synonym:BIMP2; CARMA2; PRP; PSORS2; PSS1
Exon (9)1044..1107
Gene:CARD14
Gene Synonym:BIMP2; CARMA2; PRP; PSORS2; PSS1
Exon (10)1108..1633
Gene:CARD14
Gene Synonym:BIMP2; CARMA2; PRP; PSORS2; PSS1
Translation MVSSCELELQEQSLRTASDQESGDEELNRLKEENEKLRSLTFSLAEKDILEQSLDEARGS RQELVERIHSLRERAVAAERQREQYWEEKEQTLLQFQKSKMACQLYREKVNALQAQVCEL QKERDQAYSARDSAQREISQSLVEKDSLRRQVFELTDQVCELRTQLRQLQAEPPGVLKQE ARTREPCPREKQRLVRMHAICPRDDSDCSLVSSTESQLLSDLSATSSRELVDSFRSSSPA PPSQQSLYKRVAEDFGEEPWSFSSCLEIPEGDPGALPGAKAGDPHLDYELLDTADLPQLE SSLQPVSPGRLDVSESGVLMRRRPARRILSQVTMLAFQGDALLEQISVIGGNLTGIFIHR VTPGSAADQMALRPGTQIVMVSRARPLLSPGLLMGTVAAGGVTQADFTSPRRCRSTLGWA SALSWADVKRSAHL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
109+a, gdbSNP:188508718
complement(116)-g, adbSNP:3813064
117+a, gdbSNP:374433439
130+dbSNP:
130+g, tdbSNP:369755459
132+g, tdbSNP:142246283
143+a, gdbSNP:200837077
158+a, cdbSNP:114218658
169+c, tdbSNP:140720686
197+a, tdbSNP:150138223
215+a, gdbSNP:144570537
245+c, tdbSNP:138616955
273+a, g, tdbSNP:117360605
276+a, cdbSNP:149318654
277+a, gdbSNP:150424747
302+dbSNP:
302+c, gdbSNP:145367674
303+a, gdbSNP:281875219
313+a, gdbSNP:371000277
319+a, cdbSNP:374349263
325+c, tdbSNP:368286986
330+c, tdbSNP:139466192
374+a, cdbSNP:371741250
380+a, cdbSNP:145167842
395+a, gdbSNP:374933789
404+c, tdbSNP:367867373
405+a, gdbSNP:138991161
409+a, gdbSNP:144207494
430+dbSNP:
430+a, gdbSNP:374567999
461+a, gdbSNP:200132496
513+a, gdbSNP:367635878
514+c, tdbSNP:140246774
515+a, gdbSNP:145206790
521+c, tdbSNP:202149094
526+a, gdbSNP:147977852
540+dbSNP:
540+c, tdbSNP:141698692
541+a, gdbSNP:373435882
548+a, gdbSNP:375882704
583+c, gdbSNP:150536049
619+c, tdbSNP:74951924
620+a, gdbSNP:369150206
627+c, tdbSNP:149287760
637+c, gdbSNP:147432650
640+c, tdbSNP:201501775
641+c, gdbSNP:139740020
647+c, tdbSNP:144636413
648+a, gdbSNP:147466598
676+a, gdbSNP:373415766
713+dbSNP:
713+a, gdbSNP:61751629
725+c, tdbSNP:201308755
726+a, gdbSNP:199537188
737+c, tdbSNP:142895605
772+c, tdbSNP:11658460
801+c, tdbSNP:199571417
807+dbSNP:
807+c, gdbSNP:199793195
811+a, gdbSNP:200592374
814+c, tdbSNP:141045409
820+a, gdbSNP:62074378
834+c, tdbSNP:368239982
835+a, gdbSNP:146882682
845+a, gdbSNP:140734867
863+c, tdbSNP:145876317
864+a, gdbSNP:377226624
871+c, tdbSNP:137954126
877+c, tdbSNP:368432283
896+c, tdbSNP:374170794
917+a, gdbSNP:372805579
920+a, gdbSNP:149030007
925+c, tdbSNP:144710573
926+a, gdbSNP:374847486
948+c, gdbSNP:369200145
954+dbSNP:
954+a, gdbSNP:377069416
955+c, tdbSNP:200960057
966+c, tdbSNP:61751630
967+a, gdbSNP:111586978
979+a, gdbSNP:376285944
983+c, gdbSNP:200536688
991+a, gdbSNP:61751631
1024+c, tdbSNP:369503344
1038+c, tdbSNP:373004800
1039+a, gdbSNP:138100360
1042+a, gdbSNP:143761306
1052+dbSNP:
1052+c, tdbSNP:202166921
1084+a, tdbSNP:201185269
complement(1090)-g, cdbSNP:2066964
1101+c, tdbSNP:201449588
1102+a, gdbSNP:369746581
1108+dbSNP:
1108+c, tdbSNP:139274935
1110+c, gdbSNP:199869324
1111+c, tdbSNP:149971215
1121+c, tdbSNP:373983740
1129+a, gdbSNP:377602344
1149+a, gdbSNP:370687430
1154+a, gdbSNP:199643115
1168+a, gdbSNP:144296948
1177+a, gdbSNP:375480599
1188+c, tdbSNP:201897872
1202+a, gdbSNP:34367357
1207+c, tdbSNP:143677083
1208+a, gdbSNP:146855402
1210+a, c, tdbSNP:200610907
1211+a, gdbSNP:372197132
1221+c, tdbSNP:200102454
1222+a, gdbSNP:140661251
1227+a, tdbSNP:281875220
1235+c, tdbSNP:144549093
1238+c, tdbSNP:73429414
1239+a, gdbSNP:201920372
1254+c, tdbSNP:201285077
1255+a, gdbSNP:113127952
1256+a, gdbSNP:150081068
1261+a, gdbSNP:367702181
1276+a, gdbSNP:200102317
1277+c, tdbSNP:371910172
1278+a, gdbSNP:372001018
1289+c, tdbSNP:374763410
1294+c, tdbSNP:369089693
1299+c, tdbSNP:145521869
1300+a, gdbSNP:373961754
1309+c, tdbSNP:371686462
1310+a, gdbSNP:141266944
1316+c, tdbSNP:146951890
1356+c, tdbSNP:376538051
1357+a, gdbSNP:201797957
1387+c, tdbSNP:201289274
1390+c, gdbSNP:375085546
1394+c, tdbSNP:200379060
1395+a, gdbSNP:138158068
1396+a, gdbSNP:373358452
1414+c, tdbSNP:73429416
1455+c, gdbSNP:143190446
1470+c, gdbSNP:372890711
1474+c, tdbSNP:56067448
1479+c, gdbSNP:201939938
1480+a, gdbSNP:112426199
1502+c, tdbSNP:200433649
1503+a, gdbSNP:201661624
1505+a, gdbSNP:372014836
1510+g, tdbSNP:144885499
1559+a, gdbSNP:140818498
Gene SymbolCARD14
Gene SynonymBIMP2; CARMA2; PRP; PSORS2; PSS1
Chromosome17
Locus Map17q25
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_052819 Homo sapiens caspase recruitment domain family, member 14 (CARD14), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_052819 Homo sapiens caspase recruitment domain family, member 14 (CARD14), transcript variant 2, mRNA. On-demand $219.00 7-9
NM_052819 Homo sapiens caspase recruitment domain family, member 14 (CARD14), transcript variant 2, mRNA. On-demand $219.00 7-9
Title SNP rs11652075 in the CARD14 gene as a risk factor for psoriasis (PSORS2) in a Spanish cohort .
Author Gonzalez-Lara L, Coto-Segura P, Penedo A, Eiris N, Diaz M, Santos-Juanes J, Queiro R and Coto E.
Journal DNA Cell Biol. 32 (10), 601-604 (2013)
Title [Molecular identification of the PSORS2 locus: mutations and polymorphisms in CARD14 gene] .
Author Dereure O.
Journal Ann Dermatol Venereol 140 (1), 65-66 (2013)
Title Familial pityriasis rubra pilaris is caused by mutations in CARD14 .
Author Fuchs-Telem D, Sarig O, van Steensel MA, Isakov O, Israeli S, Nousbeck J, Richard K, Winnepenninckx V, Vernooij M, Shomron N, Uitto J, Fleckman P, Richard G and Sprecher E.
Journal Am. J. Hum. Genet. 91 (1), 163-170 (2012)
Title Rare and common variants in CARD14, encoding an epidermal regulator of NF-kappaB, in psoriasis .
Author Jordan CT, Cao L, Roberson ED, Duan S, Helms CA, Nair RP, Duffin KC, Stuart PE, Goldgar D, Hayashi G, Olfson EH, Feng BJ, Pullinger CR, Kane JP, Wise CA, Goldbach-Mansky R, Lowes MA, Peddle L, Chandran V, Liao W, Rahman P, Krueger GG, Gladman D, Elder JT, Menter A and Bowcock AM.
Journal Am. J. Hum. Genet. 90 (5), 796-808 (2012)
Title PSORS2 is due to mutations in CARD14 .
Author Jordan CT, Cao L, Roberson ED, Pierson KC, Yang CF, Joyce CE, Ryan C, Duan S, Helms CA, Liu Y, Chen Y, McBride AA, Hwu WL, Wu JY, Chen YT, Menter A, Goldbach-Mansky R, Lowes MA and Bowcock AM.
Journal Am. J. Hum. Genet. 90 (5), 784-795 (2012)
Title Alternative splicing of CARMA2/CARD14 transcripts generates protein variants with differential effect on NF-kappaB activation and endoplasmic reticulum stress-induced cell death .
Author Scudiero I, Zotti T, Ferravante A, Vessichelli M, Vito P and Stilo R.
Journal J. Cell. Physiol. 226 (12), 3121-3131 (2011)
Title Card10 is a novel caspase recruitment domain/membrane-associated guanylate kinase family member that interacts with BCL10 and activates NF-kappa B .
Author Wang L, Guo Y, Huang WJ, Ke X, Poyet JL, Manji GA, Merriam S, Glucksmann MA, DiStefano PS, Alnemri ES and Bertin J.
Journal J. Biol. Chem. 276 (24), 21405-21409 (2001)
Title Carma1, a CARD-containing binding partner of Bcl10, induces Bcl10 phosphorylation and NF-kappaB activation .
Author Gaide O, Martinon F, Micheau O, Bonnet D, Thome M and Tschopp J.
Journal FEBS Lett. 496 (2-3), 121-127 (2001)
Title CARD11 and CARD14 are novel caspase recruitment domain (CARD)/membrane-associated guanylate kinase (MAGUK) family members that interact with BCL10 and activate NF-kappa B .
Author Bertin J, Wang L, Guo Y, Jacobson MD, Poyet JL, Srinivasula SM, Merriam S, DiStefano PS and Alnemri ES.
Journal J. Biol. Chem. 276 (15), 11877-11882 (2001)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.