• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens olfactory receptor, family 6, subfamily C, member 2 (OR6C2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_054105 Homo sapiens olfactory receptor, family 6, subfamily C, member 2 (OR6C2), mRNA. GenEZ ORF Cloning On-demand $449.00 14

*Business Day

Related Services

RefSeq Version NM_054105.1, 50080218
Length 939 bp
Structure linear
Update Date 25-MAR-2012
Organism Homo sapiens (human)
Definition Homo sapiens olfactory receptor, family 6, subfamily C, member 2 (OR6C2), mRNA.
Product olfactory receptor 6C2
Comment

Summary: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].

RefSeq NP_473446.1
CDS 1..939
Misc Feature(1)70..132
Misc Feature(2)70..132
Misc Feature(3)142..864
Misc Feature(4)157..219
Misc Feature(5)292..354
Misc Feature(6)409..843
Misc Feature(7)412..474
Misc Feature(8)586..645
Misc Feature(9)706..768
Misc Feature(10)808..870
Translation MKNHTVIRTFILLGLTGDPHLQVLLFIFLFLTYMLSVTGNLTIITLTLVDHHLKTPMYFF LRNFSFLEVSFTTVCIPRFLYNISMGDNTITYNACASQIFFVILFGATEFFLLAAMSYDR YVAICKPLHYVVIMNNRVCTLLVLCCWVAGLMIIVPPLSLGLQLEFCDSNAIDHFSCDAG PLLKISCSDTWVIEQMVILMAVFALIITLVCVILSYLYIVRTILKFPSVQQRKKAFSTCS SHMIVVSIAYGSCIFIYIKPSAKDEVAINKGVSVLTTSVAPLLNPFIYTLRNKQVKQAFS DSIKRIAFLSKK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Gene SymbolOR6C2
Gene SynonymOR6C67
Chromosome12
Locus Map12q13.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_054105 Homo sapiens olfactory receptor, family 6, subfamily C, member 2 (OR6C2), mRNA. On-demand $449.00 14
Title The finished DNA sequence of human chromosome 12 .
Author Scherer,S.E., Muzny,D.M., Buhay,C.J., Chen,R., Cree,A., Ding,Y., Dugan-Rocha,S., Gill,R., Gunaratne,P., Harris,R.A., Hawes,A.C., Hernandez,J., Hodgson,A.V., Hume,J., Jackson,A., Khan,Z.M., Kovar-Smith,C., Lewis,L.R., Lozado,R.J., Metzker,M.L., Milosavljevic,A., Miner,G.R., Montgomery,K.T., Morgan,M.B., Nazareth,L.V., Scott,G., Sodergren,E., Song,X.Z., Steffen,D., Lovering,R.C., Wheeler,D.A., Worley,K.C., Yuan,Y., Zhang,Z., Adams,C.Q., Ansari-Lari,M.A., Ayele,M., Brown,M.J., Chen,G., Chen,Z., Clerc-Blankenburg,K.P., Davis,C., Delgado,O., Dinh,H.H., Draper,H., Gonzalez-Garay,M.L., Havlak,P., Jackson,L.R., Jacob,L.S., Kelly,S.H., Li,L., Li,Z., Liu,J., Liu,W., Lu,J., Maheshwari,M., Nguyen,B.V., Okwuonu,G.O., Pasternak,S., Perez,L.M., Plopper,F.J., Santibanez,J., Shen,H., Tabor,P.E., Verduzco,D., Waldron,L., Wang,Q., Williams,G.A., Zhang,J., Zhou,J., Allen,C.C., Amin,A.G., Anyalebechi,V., Bailey,M., Barbaria,J.A., Bimage,K.E., Bryant,N.P., Burch,P.E., Burkett,C.E., Burrell,K.L., Calderon,E., Cardenas,V., Carter,K., Casias,K., Cavazos,I., Cavazos,S.R., Ceasar,H., Chacko,J., Chan,S.N., Chavez,D., Christopoulos,C., Chu,J., Cockrell,R., Cox,C.D., Dang,M., Dathorne,S.R., David,R., Davis,C.M., Davy-Carroll,L., Deshazo,D.R., Donlin,J.E., D'Souza,L., Eaves,K.A., Egan,A., Emery-Cohen,A.J., Escotto,M., Flagg,N., Forbes,L.D., Gabisi,A.M., Garza,M., Hamilton,C., Henderson,N., Hernandez,O., Hines,S., Hogues,M.E., Huang,M., Idlebird,D.G., Johnson,R., Jolivet,A., Jones,S., Kagan,R., King,L.M., Leal,B., Lebow,H., Lee,S., LeVan,J.M., Lewis,L.C., London,P., Lorensuhewa,L.M., Loulseged,H., Lovett,D.A., Lucier,A., Lucier,R.L., Ma,J., Madu,R.C., Mapua,P., Martindale,A.D., Martinez,E., Massey,E., Mawhiney,S., Meador,M.G., Mendez,S., Mercado,C., Mercado,I.C., Merritt,C.E., Miner,Z.L., Minja,E., Mitchell,T., Mohabbat,F., Mohabbat,K., Montgomery,B., Moore,N., Morris,S., Munidasa,M., Ngo,R.N., Nguyen,N.B., Nickerson,E., Nwaokelemeh,O.O., Nwokenkwo,S., Obregon,M., Oguh,M., Oragunye,N., Oviedo,R.J., Parish,B.J., Parker,D.N., Parrish,J., Parks,K.L., Paul,H.A., Payton,B.A., Perez,A., Perrin,W., Pickens,A., Primus,E.L., Pu,L.L., Puazo,M., Quiles,M.M., Quiroz,J.B., Rabata,D., Reeves,K., Ruiz,S.J., Shao,H., Sisson,I., Sonaike,T., Sorelle,R.P., Sutton,A.E., Svatek,A.F., Svetz,L.A., Tamerisa,K.S., Taylor,T.R., Teague,B., Thomas,N., Thorn,R.D., Trejos,Z.Y., Trevino,B.K., Ukegbu,O.N., Urban,J.B., Vasquez,L.I., Vera,V.A., Villasana,D.M., Wang,L., Ward-Moore,S., Warren,J.T., Wei,X., White,F., Williamson,A.L., Wleczyk,R., Wooden,H.S., Wooden,S.H., Yen,J., Yoon,L., Yoon,V., Zorrilla,S.E., Nelson,D., Kucherlapati,R., Weinstock,G. and Gibbs,R.A.
Journal Nature 440 (7082), 346-351 (2006)
Title The olfactory receptor gene repertoire in primates and mouse: evidence for reduction of the functional fraction in primates .
Author Rouquier,S., Blancher,A. and Giorgi,D.
Journal Proc. Natl. Acad. Sci. U.S.A. 97 (6), 2870-2874 (2000)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.