• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens olfactory receptor, family 6, subfamily C, member 2 (OR6C2), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_054105 Homo sapiens olfactory receptor, family 6, subfamily C, member 2 (OR6C2), mRNA. Full Lenth $272.31
ORF Sequence $272.31


RefSeq Version NM_054105.1, 50080218
Length 939 bp
Structure linear
Update Date 26-DEC-2010
Organism Homo sapiens (human)
Definition Homo sapiens olfactory receptor, family 6, subfamily C, member 2 (OR6C2), mRNA.
Product olfactory receptor 6C2
Comment

Summary: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq].

RefSeq NP_473446.1
CDS 1..939
Exon (1)1..939
Translation MKNHTVIRTFILLGLTGDPHLQVLLFIFLFLTYMLSVTGNLTIITLTLVDHHLKTPMYFF LRNFSFLEVSFTTVCIPRFLYNISMGDNTITYNACASQIFFVILFGATEFFLLAAMSYDR YVAICKPLHYVVIMNNRVCTLLVLCCWVAGLMIIVPPLSLGLQLEFCDSNAIDHFSCDAG PLLKISCSDTWVIEQMVILMAVFALIITLVCVILSYLYIVRTILKFPSVQQRKKAFSTCS SHMIVVSIAYGSCIFIYIKPSAKDEVAINKGVSVLTTSVAPLLNPFIYTLRNKQVKQAFS DSIKRIAFLSKK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
183+c, tdbSNP:114420888
206..207+, gdbSNP:34885470
414+a, gdbSNP:116474529
460+a, gdbSNP:76568393
541+c, gdbSNP:11171466
585+g, tdbSNP:114412367
626+c, tdbSNP:11171467
652+g, tdbSNP:12817326
734+g, tdbSNP:12810501
757+c, tdbSNP:112079573
776+a, gdbSNP:73339457
797+a, tdbSNP:78804313
893+c, tdbSNP:74092333
Gene SymbolOR6C2
Gene SynonymOR6C67
Chromosome12
Locus Map12q13.2
All Transcripts NM_054105
Title The finished DNA sequence of human chromosome 12 .
Author Scherer,S.E., Muzny,D.M., Buhay,C.J., Chen,R., Cree,A., Ding,Y., Dugan-Rocha,S., Gill,R., Gunaratne,P., Harris,R.A., Hawes,A.C., Hernandez,J., Hodgson,A.V., Hume,J., Jackson,A., Khan,Z.M., Kovar-Smith,C., Lewis,L.R., Lozado,R.J., Metzker,M.L., Milosavljevic,A., Miner,G.R., Montgomery,K.T., Morgan,M.B., Nazareth,L.V., Scott,G., Sodergren,E., Song,X.Z., Steffen,D., Lovering,R.C., Wheeler,D.A., Worley,K.C., Yuan,Y., Zhang,Z., Adams,C.Q., Ansari-Lari,M.A., Ayele,M., Brown,M.J., Chen,G., Chen,Z., Clerc-Blankenburg,K.P., Davis,C., Delgado,O., Dinh,H.H., Draper,H., Gonzalez-Garay,M.L., Havlak,P., Jackson,L.R., Jacob,L.S., Kelly,S.H., Li,L., Li,Z., Liu,J., Liu,W., Lu,J., Maheshwari,M., Nguyen,B.V., Okwuonu,G.O., Pasternak,S., Perez,L.M., Plopper,F.J., Santibanez,J., Shen,H., Tabor,P.E., Verduzco,D., Waldron,L., Wang,Q., Williams,G.A., Zhang,J., Zhou,J., Allen,C.C., Amin,A.G., Anyalebechi,V., Bailey,M., Barbaria,J.A., Bimage,K.E., Bryant,N.P., Burch,P.E., Burkett,C.E., Burrell,K.L., Calderon,E., Cardenas,V., Carter,K., Casias,K., Cavazos,I., Cavazos,S.R., Ceasar,H., Chacko,J., Chan,S.N., Chavez,D., Christopoulos,C., Chu,J., Cockrell,R., Cox,C.D., Dang,M., Dathorne,S.R., David,R., Davis,C.M., Davy-Carroll,L., Deshazo,D.R., Donlin,J.E., D'Souza,L., Eaves,K.A., Egan,A., Emery-Cohen,A.J., Escotto,M., Flagg,N., Forbes,L.D., Gabisi,A.M., Garza,M., Hamilton,C., Henderson,N., Hernandez,O., Hines,S., Hogues,M.E., Huang,M., Idlebird,D.G., Johnson,R., Jolivet,A., Jones,S., Kagan,R., King,L.M., Leal,B., Lebow,H., Lee,S., LeVan,J.M., Lewis,L.C., London,P., Lorensuhewa,L.M., Loulseged,H., Lovett,D.A., Lucier,A., Lucier,R.L., Ma,J., Madu,R.C., Mapua,P., Martindale,A.D., Martinez,E., Massey,E., Mawhiney,S., Meador,M.G., Mendez,S., Mercado,C., Mercado,I.C., Merritt,C.E., Miner,Z.L., Minja,E., Mitchell,T., Mohabbat,F., Mohabbat,K., Montgomery,B., Moore,N., Morris,S., Munidasa,M., Ngo,R.N., Nguyen,N.B., Nickerson,E., Nwaokelemeh,O.O., Nwokenkwo,S., Obregon,M., Oguh,M., Oragunye,N., Oviedo,R.J., Parish,B.J., Parker,D.N., Parrish,J., Parks,K.L., Paul,H.A., Payton,B.A., Perez,A., Perrin,W., Pickens,A., Primus,E.L., Pu,L.L., Puazo,M., Quiles,M.M., Quiroz,J.B., Rabata,D., Reeves,K., Ruiz,S.J., Shao,H., Sisson,I., Sonaike,T., Sorelle,R.P., Sutton,A.E., Svatek,A.F., Svetz,L.A., Tamerisa,K.S., Taylor,T.R., Teague,B., Thomas,N., Thorn,R.D., Trejos,Z.Y., Trevino,B.K., Ukegbu,O.N., Urban,J.B., Vasquez,L.I., Vera,V.A., Villasana,D.M., Wang,L., Ward-Moore,S., Warren,J.T., Wei,X., White,F., Williamson,A.L., Wleczyk,R., Wooden,H.S., Wooden,S.H., Yen,J., Yoon,L., Yoon,V., Zorrilla,S.E., Nelson,D., Kucherlapati,R., Weinstock,G. and Gibbs,R.A.
Journal Nature 440 (7082), 346-351 (2006)
Title The olfactory receptor gene repertoire in primates and mouse: evidence for reduction of the functional fraction in primates .
Author Rouquier,S., Blancher,A. and Giorgi,D.
Journal Proc. Natl. Acad. Sci. U.S.A. 97 (6), 2870-2874 (2000)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878