• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens keratin 3 (KRT3), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_057088 Homo sapiens keratin 3 (KRT3), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_057088.2, 109148551
Length 2327 bp
Structure linear
Update Date 18-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens keratin 3 (KRT3), mRNA.
Product keratin, type II cytoskeletal 3
Comment

Summary: The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the corneal epithelium with family member KRT12 and mutations in these genes have been associated with Meesmann's Corneal Dystrophy. The type II cytokeratins are clustered in a region of chromosome 12q12-q13. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: AJ628418.1, AK314987.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_476429.2
CDS 67..1953
Misc Feature(1)67..657
Misc Feature(2)67..657
Misc Feature(3)655..1602
Misc Feature(4)658..1593
Misc Feature(5)658..765
Misc Feature(6)766..828
Misc Feature(7)829..1104
Misc Feature(8)1105..1176
Misc Feature(9)1177..1593
Misc Feature(10)1594..1950
Exon (1)1..711
Gene:KRT3
Gene Synonym:CK3; K3
Exon (2)712..932
Gene:KRT3
Gene Synonym:CK3; K3
Exon (3)933..993
Gene:KRT3
Gene Synonym:CK3; K3
Exon (4)994..1089
Gene:KRT3
Gene Synonym:CK3; K3
Exon (5)1090..1254
Gene:KRT3
Gene Synonym:CK3; K3
Exon (6)1255..1380
Gene:KRT3
Gene Synonym:CK3; K3
Exon (7)1381..1601
Gene:KRT3
Gene Synonym:CK3; K3
Exon (8)1602..1636
Gene:KRT3
Gene Synonym:CK3; K3
Exon (9)1637..2310
Gene:KRT3
Gene Synonym:CK3; K3
Translation MSRQASKTSGGGSQGFSGRSAVVSGSSRMSCVAHSGGAGGGAYGFRSGAGGFGSRSLYNL GGNKSISISVAAGGSRAGGFGGGRSSCAFAGGYGGGFGSGYGGGFGGGFGGGRGMGGGFG GAGGFGGAGGFGGAGGFGGPGGFGGSGGFGGPGSLGSPGGFGPGGFPGGIQEVTINQSLL QPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQQGTSS ISGTNNLEPLFENHINYLRSYLDNILGERGRLDSELKNMEDLVEDFKKKYEDEINKRTAA ENEFVTLKKDVDSAYMNKVELQAKVDALIDEIDFLRTLYDAELSQMQSHISDTSVVLSMD NNRSLDLDSIIAEVRAQYEDIAQRSKAEAEALYQTKLGELQTTAGRHGDDLRNTKSEIIE LNRMIQRLRAEIEGVKKQNANLQTAIAEAEQHGEMALKDANAKLQELQAALQQAKDDLAR LLRDYQELMNVKLALDVEIATYRKLLEGEEYRMSGECPSAVSISVVSSSTTSASAGGYGG GYGGGMGGGLGGGFSAGGGSGSGFGRGGGGGIGGGFGGGSSGFSGGSGFGSISGARYGVS GGGFSSASNRGGSIKFSQSSQSSQRYSR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(51)-dbSNP:
complement(51)-g, adbSNP:146391233
complement(92)-g, adbSNP:143951674
complement(105)-g, cdbSNP:201738438
complement(117)-g, adbSNP:200988929
complement(159)-g, adbSNP:139995578
complement(181)-t, cdbSNP:202180550
complement(184)-t, cdbSNP:199902669
complement(194)-t, cdbSNP:200847081
complement(197)-g, cdbSNP:28721426
complement(269)-c, adbSNP:201564104
complement(272)-t, cdbSNP:199517745
complement(274)-t, cdbSNP:150657845
complement(285)-t, g, adbSNP:200878892
complement(293)-t, cdbSNP:201539577
complement(300)-t, cdbSNP:202183688
complement(316)-g, adbSNP:62617086
complement(320)-t, cdbSNP:200265010
complement(329)-g, cdbSNP:200393349
complement(363)-g, adbSNP:148001170
complement(364)-t, cdbSNP:188384912
complement(374)-g, cdbSNP:112593469
complement(381)-t, g, cdbSNP:111435734
complement(396)-t, adbSNP:201238000
complement(444)-t, adbSNP:147386788
complement(447)-t, cdbSNP:117364830
complement(448..465)-, ccctccaaagccaccagcdbSNP:148531142
complement(462)-t, adbSNP:142692092
complement(465)-c, adbSNP:184322044
complement(519)-, cccaccaaagccaccagadbSNP:68098033
complement(576)-c, adbSNP:193011168
complement(661)-g, adbSNP:138693059
complement(667)-g, adbSNP:200301715
complement(711)-t, cdbSNP:187803154
complement(715)-dbSNP:
complement(715)-g, adbSNP:199929228
complement(735)-g, cdbSNP:200585096
complement(772)-g, cdbSNP:76767665
complement(790)-g, adbSNP:115512783
complement(841)-g, adbSNP:201818737
complement(842)-t, cdbSNP:199804632
complement(951)-dbSNP:
complement(951)-g, adbSNP:182554932
complement(955)-g, adbSNP:201121196
complement(970)-t, cdbSNP:201472315
complement(986)-t, adbSNP:191432292
complement(1007)-dbSNP:
complement(1007)-g, adbSNP:199614200
complement(1041)-c, adbSNP:114915149
complement(1052)-g, adbSNP:114078275
complement(1062)-g, adbSNP:144405688
complement(1083)-g, adbSNP:200246450
complement(1086)-g, adbSNP:150031039
complement(1093)-dbSNP:
complement(1093)-t, gdbSNP:116142090
complement(1122)-g, adbSNP:115678044
complement(1154)-t, cdbSNP:200973641
complement(1155)-g, adbSNP:4432093
complement(1168)-c, adbSNP:200059777
complement(1182)-g, adbSNP:202245534
complement(1189)-g, cdbSNP:3887954
complement(1274)-dbSNP:
complement(1274)-g, adbSNP:200151587
complement(1290)-t, cdbSNP:201333279
complement(1314)-g, adbSNP:141642714
complement(1350)-t, cdbSNP:148055325
complement(1363)-t, cdbSNP:61929765
complement(1393)-dbSNP:
complement(1393)-g, adbSNP:148874235
complement(1397)-g, adbSNP:199625544
complement(1407)-t, gdbSNP:200194933
complement(1414)-t, cdbSNP:189910350
complement(1487)-g, adbSNP:201927015
complement(1503)-t, cdbSNP:201814725
complement(1555)-t, cdbSNP:200588015
1559+a, tdbSNP:267607431
complement(1574)-g, cdbSNP:60410063
complement(1579)-g, adbSNP:200542944
complement(1591)-g, adbSNP:57872071
complement(1673)-dbSNP:
complement(1673)-, cdbSNP:35394995
complement(1696)-t, cdbSNP:184297044
complement(1727)-c, adbSNP:199840248
complement(1779)-t, cdbSNP:200112473
complement(1800..1801)-, accgctgaaaccgctgctgccdbSNP:60125653
complement(1868)-t, cdbSNP:192685142
complement(1897)-t, cdbSNP:187547495
complement(1968)-g, adbSNP:80023802
complement(2037)-g, adbSNP:182886024
complement(2204)-t, gdbSNP:150187400
complement(2216)-g, adbSNP:140954861
complement(2287)-t, cdbSNP:190637355
Gene SymbolKRT3
Gene SynonymCK3; K3
Chromosome12
Locus Map12q13.13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_057088 Homo sapiens keratin 3 (KRT3), mRNA. On-demand TBD TBD
Title Genetics of Meesmann corneal dystrophy: a novel mutation in the keratin 3 gene in an asymptomatic family suggests genotype-phenotype correlation .
Author Szaflik,J.P., Oldak,M., Maksym,R.B., Kaminska,A., Pollak,A., Udziela,M., Ploski,R. and Szaflik,J.
Journal Mol. Vis. 14, 1713-1718 (2008)
Title New consensus nomenclature for mammalian keratins .
Author Schweizer,J., Bowden,P.E., Coulombe,P.A., Langbein,L., Lane,E.B., Magin,T.M., Maltais,L., Omary,M.B., Parry,D.A., Rogers,M.A. and Wright,M.W.
Journal J. Cell Biol. 174 (2), 169-174 (2006)
Title Novel mutations in the helix termination motif of keratin 3 and keratin 12 in 2 Taiwanese families with Meesmann corneal dystrophy .
Author Chen,Y.T., Tseng,S.H. and Chao,S.C.
Journal Cornea 24 (8), 928-932 (2005)
Title Characterization of new members of the human type II keratin gene family and a general evaluation of the keratin gene domain on chromosome 12q13.13 .
Author Rogers,M.A., Edler,L., Winter,H., Langbein,L., Beckmann,I. and Schweizer,J.
Journal J. Invest. Dermatol. 124 (3), 536-544 (2005)
Title Mutations in cornea-specific keratin K3 or K12 genes cause Meesmann's corneal dystrophy .
Author Irvine,A.D., Corden,L.D., Swensson,O., Swensson,B., Moore,J.E., Frazer,D.G., Smith,F.J., Knowlton,R.G., Christophers,E., Rochels,R., Uitto,J. and McLean,W.H.
Journal Nat. Genet. 16 (2), 184-187 (1997)
Title Assignment of the human cytokeratin 3 gene (KRT3) to 12q12-->q13 by .
Author Raimondi,E., Moralli,D., De Carli,L., Ceratto,N., Balzaretti,M., Leube,R., Collin,C. and Romano,V.
Journal Cytogenet. Cell Genet. 66 (3), 162-163 (1994)
Title Evolution of keratin genes: different protein domains evolve by different pathways .
Author Klinge,E.M., Sylvestre,Y.R., Freedberg,I.M. and Blumenberg,M.
Journal J. Mol. Evol. 24 (4), 319-329 (1987)
Title The catalog of human cytokeratins: patterns of expression in normal epithelia, tumors and cultured cells .
Author Moll,R., Franke,W.W., Schiller,D.L., Geiger,B. and Krepler,R.
Journal Cell 31 (1), 11-24 (1982)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.