• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens keratin 3 (KRT3), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu17842 Homo sapiens keratin 3 (KRT3), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu17842C Homo sapiens keratin 3 (KRT3), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_057088.2, 109148551
Length 1887 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens keratin 3 (KRT3), mRNA.
Product keratin, type II cytoskeletal 3
Comment

Summary: The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the corneal epithelium with family member KRT12 and mutations in these genes have been associated with Meesmann's Corneal Dystrophy. The type II cytokeratins are clustered in a region of chromosome 12q12-q13. [provided by RefSeq, Jul 2008].


##Evidence-Data-START## Transcript exon combination :: AJ628418.1, AK314987.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.

RefSeq NP_476429.2
CDS 67..1953
Misc Feature(1)67..657
Misc Feature(2)67..657
Misc Feature(3)655..1602
Misc Feature(4)658..1593
Misc Feature(5)658..765
Misc Feature(6)766..828
Misc Feature(7)829..1104
Misc Feature(8)1105..1176
Misc Feature(9)1177..1593
Misc Feature(10)<1210..1494
Misc Feature(11)1594..1950
Exon (1)1..711
Gene:KRT3
Gene Synonym:CK3; K3
Exon (2)712..932
Gene:KRT3
Gene Synonym:CK3; K3
Exon (3)933..993
Gene:KRT3
Gene Synonym:CK3; K3
Exon (4)994..1089
Gene:KRT3
Gene Synonym:CK3; K3
Exon (5)1090..1254
Gene:KRT3
Gene Synonym:CK3; K3
Exon (6)1255..1380
Gene:KRT3
Gene Synonym:CK3; K3
Exon (7)1381..1601
Gene:KRT3
Gene Synonym:CK3; K3
Exon (8)1602..1636
Gene:KRT3
Gene Synonym:CK3; K3
Exon (9)1637..2310
Gene:KRT3
Gene Synonym:CK3; K3
Translation MSRQASKTSGGGSQGFSGRSAVVSGSSRMSCVAHSGGAGGGAYGFRSGAGGFGSRSLYNL GGNKSISISVAAGGSRAGGFGGGRSSCAFAGGYGGGFGSGYGGGFGGGFGGGRGMGGGFG GAGGFGGAGGFGGAGGFGGPGGFGGSGGFGGPGSLGSPGGFGPGGFPGGIQEVTINQSLL QPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQQGTSS ISGTNNLEPLFENHINYLRSYLDNILGERGRLDSELKNMEDLVEDFKKKYEDEINKRTAA ENEFVTLKKDVDSAYMNKVELQAKVDALIDEIDFLRTLYDAELSQMQSHISDTSVVLSMD NNRSLDLDSIIAEVRAQYEDIAQRSKAEAEALYQTKLGELQTTAGRHGDDLRNTKSEIIE LNRMIQRLRAEIEGVKKQNANLQTAIAEAEQHGEMALKDANAKLQELQAALQQAKDDLAR LLRDYQELMNVKLALDVEIATYRKLLEGEEYRMSGECPSAVSISVVSSSTTSASAGGYGG GYGGGMGGGLGGGFSAGGGSGSGFGRGGGGGIGGGFGGGSSGFSGGSGFGSISGARYGVS GGGFSSASNRGGSIKFSQSSQSSQRYSR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(51)-dbSNP:
complement(51)-g, adbSNP:146391233
complement(92)-g, adbSNP:143951674
complement(105)-g, cdbSNP:201738438
complement(117)-g, adbSNP:200988929
complement(122)-t, cdbSNP:376108603
complement(159)-g, adbSNP:139995578
complement(175)-t, cdbSNP:267603529
complement(179)-g, cdbSNP:374910086
complement(181)-t, cdbSNP:202180550
complement(183)-g, adbSNP:372694149
complement(184)-t, cdbSNP:199902669
complement(194)-t, cdbSNP:200847081
complement(197)-g, cdbSNP:28721426
complement(202)-g, adbSNP:368389807
complement(204)-g, cdbSNP:377002190
complement(207)-g, adbSNP:372128289
complement(208)-t, cdbSNP:370673258
complement(249)-g, adbSNP:368081511
complement(264)-t, gdbSNP:374767959
complement(269)-c, adbSNP:201564104
complement(272)-t, cdbSNP:199517745
complement(273)-g, adbSNP:377156370
complement(274)-t, cdbSNP:150657845
complement(285)-t, g, adbSNP:200878892
complement(293)-t, cdbSNP:201539577
complement(300)-t, cdbSNP:202183688
complement(316)-g, adbSNP:62617086
complement(320)-t, cdbSNP:200265010
complement(329)-g, cdbSNP:200393349
complement(358)-c, adbSNP:370707520
complement(363)-g, adbSNP:148001170
complement(364)-t, cdbSNP:188384912
complement(369)-g, adbSNP:376089191
complement(374)-g, cdbSNP:112593469
381+c, g, tdbSNP:111435734
complement(396)-t, adbSNP:201238000
complement(427)-t, cdbSNP:369751855
complement(430..447)-, ccctccaaagccaccagcdbSNP:148531142
complement(444)-t, adbSNP:147386788
complement(447)-t, cdbSNP:117364830
complement(462)-t, adbSNP:142692092
complement(465)-c, adbSNP:184322044
complement(489)-t, adbSNP:376823412
complement(503)-g, adbSNP:373969603
complement(546)-g, adbSNP:373105115
complement(551)-c, adbSNP:369008679
complement(576)-c, adbSNP:193011168
complement(604)-g, adbSNP:375736148
complement(616)-t, adbSNP:373468680
complement(627)-g, adbSNP:369823813
complement(653)-g, cdbSNP:367755618
complement(661)-t, cdbSNP:386471921
complement(661)-g, adbSNP:138693059
complement(662)-t, cdbSNP:372506087
complement(663)-t, cdbSNP:368255227
complement(667)-g, adbSNP:200301715
complement(711)-t, cdbSNP:187803154
complement(712)-dbSNP:
complement(712)-t, cdbSNP:367741612
complement(715)-g, adbSNP:199929228
complement(735)-g, cdbSNP:200585096
complement(747)-t, cdbSNP:374170150
complement(772)-g, cdbSNP:76767665
complement(787)-t, gdbSNP:368765001
complement(790)-g, adbSNP:115512783
complement(841)-g, adbSNP:201818737
complement(842)-t, cdbSNP:199804632
complement(872)-t, cdbSNP:377035034
complement(878)-t, cdbSNP:376246180
complement(902)-g, adbSNP:373149040
complement(951)-dbSNP:
complement(951)-g, adbSNP:182554932
complement(955)-g, adbSNP:201121196
complement(962)-g, adbSNP:369156432
complement(970)-t, cdbSNP:201472315
complement(986)-t, adbSNP:191432292
complement(1007)-dbSNP:
complement(1007)-g, adbSNP:199614200
complement(1041)-c, adbSNP:114915149
complement(1052)-g, adbSNP:114078275
complement(1062)-g, adbSNP:144405688
complement(1083)-g, adbSNP:200246450
complement(1086)-g, adbSNP:150031039
complement(1093)-dbSNP:
complement(1093)-t, gdbSNP:116142090
complement(1112)-t, cdbSNP:369586403
complement(1115)-g, adbSNP:376324209
complement(1122)-g, adbSNP:115678044
complement(1154)-t, cdbSNP:200973641
complement(1155)-g, adbSNP:4432093
complement(1168)-t, c, adbSNP:200059777
complement(1182)-g, adbSNP:202245534
complement(1189)-g, cdbSNP:3887954
complement(1204)-g, cdbSNP:369084756
complement(1227)-g, adbSNP:374548119
complement(1228)-t, cdbSNP:372108723
complement(1274)-dbSNP:
complement(1274)-g, adbSNP:200151587
complement(1290)-t, cdbSNP:201333279
complement(1314)-g, adbSNP:141642714
complement(1350)-t, cdbSNP:148055325
complement(1351)-g, adbSNP:369797699
complement(1362)-g, adbSNP:376783753
complement(1363)-t, cdbSNP:61929765
complement(1363)-t, cdbSNP:386490259
complement(1365)-t, cdbSNP:369576134
complement(1393)-dbSNP:
complement(1393)-g, adbSNP:148874235
complement(1397)-g, adbSNP:199625544
complement(1398)-t, cdbSNP:373424785
complement(1407)-t, gdbSNP:200194933
complement(1408)-t, cdbSNP:371219499
complement(1413)-t, gdbSNP:267603528
complement(1414)-t, cdbSNP:189910350
complement(1437)-g, adbSNP:376658995
complement(1467)-t, cdbSNP:369147846
complement(1476)-g, adbSNP:374904266
complement(1487)-g, adbSNP:201927015
complement(1488)-t, cdbSNP:368969102
complement(1503)-t, cdbSNP:201814725
complement(1513)-g, adbSNP:372152150
complement(1541)-t, cdbSNP:368503459
complement(1551)-t, cdbSNP:376995818
complement(1554)-g, adbSNP:372122010
complement(1555)-t, cdbSNP:200588015
1559+a, tdbSNP:267607431
1574+c, g, tdbSNP:60410063
complement(1579)-g, adbSNP:200542944
complement(1581)-t, cdbSNP:375181234
1591+a, gdbSNP:57872071
complement(1632)-dbSNP:
complement(1632)-g, cdbSNP:370680022
complement(1657)-dbSNP:
complement(1657)-t, cdbSNP:373112698
complement(1673)-, cdbSNP:35394995
complement(1684)-t, cdbSNP:369377430
complement(1696)-t, cdbSNP:184297044
complement(1719)-t, cdbSNP:375197284
complement(1727)-c, adbSNP:199840248
complement(1736)-t, cdbSNP:367763143
complement(1746)-t, cdbSNP:375768900
complement(1776)-g, adbSNP:372754733
complement(1779)-t, cdbSNP:200112473
complement(1779)-t, cdbSNP:386456831
complement(1800..1801)-, accgctgaaaccgctgctgccdbSNP:60125653
complement(1868)-t, cdbSNP:192685142
complement(1884)-t, cdbSNP:368606859
complement(1897)-t, cdbSNP:187547495
complement(1968)-g, adbSNP:80023802
complement(2037)-g, adbSNP:182886024
complement(2119)-t, adbSNP:374806228
complement(2172)-g, adbSNP:370099181
complement(2204)-t, gdbSNP:150187400
complement(2216)-g, adbSNP:140954861
complement(2287)-t, cdbSNP:190637355
Gene SymbolKRT3
Gene SynonymCK3; K3
Chromosome12
Locus Map12q13.13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_057088 Homo sapiens keratin 3 (KRT3), mRNA. On-demand TBD TBD
NM_057088 Homo sapiens keratin 3 (KRT3), mRNA. On-demand TBD TBD
NM_057088 Homo sapiens keratin 3 (KRT3), mRNA. On-demand TBD TBD
NM_057088 Homo sapiens keratin 3 (KRT3), mRNA. On-demand TBD TBD
Title Autosomal-dominant Meesmann epithelial corneal dystrophy without an exon mutation in the keratin-3 or keratin-12 gene in a Chinese family .
Author Cao W, Yan M, Hao Q, Wang S, Wu L, Liu Q, Li M, Biddle FG and Wu W.
Journal J. Int. Med. Res. 41 (2), 511-518 (2013)
Title Genetics of Meesmann corneal dystrophy: a novel mutation in the keratin 3 gene in an asymptomatic family suggests genotype-phenotype correlation .
Author Szaflik JP, Oldak M, Maksym RB, Kaminska A, Pollak A, Udziela M, Ploski R and Szaflik J.
Journal Mol. Vis. 14, 1713-1718 (2008)
Title New consensus nomenclature for mammalian keratins .
Author Schweizer J, Bowden PE, Coulombe PA, Langbein L, Lane EB, Magin TM, Maltais L, Omary MB, Parry DA, Rogers MA and Wright MW.
Journal J. Cell Biol. 174 (2), 169-174 (2006)
Title Novel mutations in the helix termination motif of keratin 3 and keratin 12 in 2 Taiwanese families with Meesmann corneal dystrophy .
Author Chen YT, Tseng SH and Chao SC.
Journal Cornea 24 (8), 928-932 (2005)
Title Characterization of new members of the human type II keratin gene family and a general evaluation of the keratin gene domain on chromosome 12q13.13 .
Author Rogers MA, Edler L, Winter H, Langbein L, Beckmann I and Schweizer J.
Journal J. Invest. Dermatol. 124 (3), 536-544 (2005)
Title Mutations in cornea-specific keratin K3 or K12 genes cause Meesmann's corneal dystrophy .
Author Irvine AD, Corden LD, Swensson O, Swensson B, Moore JE, Frazer DG, Smith FJ, Knowlton RG, Christophers E, Rochels R, Uitto J and McLean WH.
Journal Nat. Genet. 16 (2), 184-187 (1997)
Title Assignment of the human cytokeratin 3 gene (KRT3) to 12q12-->q13 by .
Author Raimondi E, Moralli D, De Carli L, Ceratto N, Balzaretti M, Leube R, Collin C and Romano V.
Journal Cytogenet. Cell Genet. 66 (3), 162-163 (1994)
Title Evolution of keratin genes: different protein domains evolve by different pathways .
Author Klinge,E.M., Sylvestre,Y.R., Freedberg,I.M. and Blumenberg,M.
Journal J. Mol. Evol. 24 (4), 319-329 (1987)
Title The catalog of human cytokeratins: patterns of expression in normal epithelia, tumors and cultured cells .
Author Moll,R., Franke,W.W., Schiller,D.L., Geiger,B. and Krepler,R.
Journal Cell 31 (1), 11-24 (1982)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.