• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens RAD51 homolog C (S. cerevisiae) (RAD51C), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_058216 Homo sapiens RAD51 homolog C (S. cerevisiae) (RAD51C), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $418.00 $369.00 10

*Business Day

Related Services

RefSeq Version NM_058216.1, 17402895
Length 1295 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens RAD51 homolog C (S. cerevisiae) (RAD51C), transcript variant 1, mRNA.
Product DNA repair protein RAD51 homolog 3 isoform 1
Comment

Summary: This gene is a member of the RAD51 family of related genes, which encode strand-transfer proteins thought to be involved in recombinational repair of damaged DNA and in meiotic recombination. This gene product interacts with two other DNA repair proteins, encoded by RAD51B and XRCC3, but not with itself. The protein copurifies with XRCC3 protein in a complex, reflecting their endogenous association and suggesting a cooperative role during recombinational repair. This gene is one of four localized to a region of chromosome 17q23 where amplification occurs frequently in breast tumors. Overexpression of the four genes during amplification has been observed and suggests a possible role in tumor progression. Alternative splicing has been observed for this gene and two variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) is the longer transcript and encodes the full-length isoform (1).

RefSeq NP_478123.1
CDS 43..1173
Misc Feature(1)70..1086
Misc Feature(2)70..1086
Misc Feature(3)340..1083
Misc Feature(4)415..438
Misc Feature(5)order(421..423,433..438,511..513,517..519,523..525,
Misc Feature(6)order(508..510,514..516,538..540,547..549,655..657,
Misc Feature(7)754..768
Misc Feature(8)1138..1152
Misc Feature(9)447..613
Misc Feature(10)447..613
Exon (1)1..187
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; RAD51L2
Exon (2)188..446
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; RAD51L2
Exon (3)447..613
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; RAD51L2
Exon (4)614..747
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; RAD51L2
Exon (5)748..879
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; RAD51L2
Exon (6)880..946
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; RAD51L2
Exon (7)947..1007
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; RAD51L2
Exon (8)1008..1068
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; RAD51L2
Exon (9)1069..1282
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; RAD51L2
Translation MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALET LQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKT TEICGAPGVGKTQLCMQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHL QLIAEKHKGEEHRKALEDFTLDNILSHIYYFRCRDYTELLAQVYLLPDFLSEHSKVRLVI VDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDRNQALLVPA LGESWGHAATIRLIFHWDRKQRLATLYKSPSQKECTVLFQIKPQGFRDTVVTSACSLQTE GSLSTRKRSRDPEEEL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
17+c, tdbSNP:12946397
19+a, cdbSNP:181444396
56+c, tdbSNP:201523760
76+c, tdbSNP:28910276
132+a, gdbSNP:115414895
192+dbSNP:
192+g, tdbSNP:1127858
225+a, gdbSNP:200531489
228+a, gdbSNP:28363303
237+a, gdbSNP:45511291
275+c, tdbSNP:112832782
291+c, gdbSNP:145387081
300+a, tdbSNP:149228565
330+c, gdbSNP:143180709
415+a, gdbSNP:142058115
416+g, tdbSNP:267606998
418+a, gdbSNP:61758784
456+c, gdbSNP:267606999
473+c, tdbSNP:28363307
495+a, gdbSNP:45553636
508..509+, gtttdbSNP:143941948
527+a, gdbSNP:35151472
555+c, tdbSNP:140279158
619+dbSNP:
619+c, tdbSNP:200293302
676+c, tdbSNP:137947462
677+a, gdbSNP:200857129
682+c, tdbSNP:140804406
698+c, tdbSNP:201529791
763+dbSNP:
763+a, gdbSNP:184033132
772+a, gdbSNP:199886026
786+c, tdbSNP:150142859
787+c, tdbSNP:28363311
815+a, gdbSNP:267606997
825+a, gdbSNP:138643096
826+g, tdbSNP:149331537
832+a, gdbSNP:147241704
901+dbSNP:
901+a, gdbSNP:28363317
932+c, tdbSNP:143026267
964+dbSNP:
964+g, tdbSNP:185057307
987+c, tdbSNP:201235884
1010+dbSNP:
1010+g, tdbSNP:147471624
1085+dbSNP:
1085+a, gdbSNP:111614311
1091+g, tdbSNP:148537339
1104+a, gdbSNP:201000407
1198+c, gdbSNP:28363336
1213+c, tdbSNP:181365564
Gene SymbolRAD51C
Gene SynonymBROVCA3; FANCO; RAD51L2
Chromosome17
Locus Map17q25.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_002876 Homo sapiens RAD51 homolog C (S. cerevisiae) (RAD51C), transcript variant 2, mRNA. On-demand $299.00 14
NM_058216 Homo sapiens RAD51 homolog C (S. cerevisiae) (RAD51C), transcript variant 1, mRNA. In-stock $418.00 $369.00 10
Title Constitutive promoter methylation of BRCA1 and RAD51C in patients with familial ovarian cancer and early-onset sporadic breast cancer .
Author Hansmann,T., Pliushch,G., Leubner,M., Kroll,P., Endt,D., Gehrig,A., Preisler-Adams,S., Wieacker,P. and Haaf,T.
Journal Hum. Mol. Genet. 21 (21), 4669-4679 (2012)
Title Predominance of pathogenic missense variants in the RAD51C gene occurring in breast and ovarian cancer families .
Author Osorio,A., Endt,D., Fernandez,F., Eirich,K., de la Hoya,M., Schmutzler,R., Caldes,T., Meindl,A., Schindler,D. and Benitez,J.
Journal Hum. Mol. Genet. 21 (13), 2889-2898 (2012)
Title High sensitivity for BRCA1/2 mutations in breast/ovarian kindreds: are there still other breast/ovary genes to be discovered? .
Author Smith,M.J., Gifford,F.L., Lalloo,F., Newman,W.G. and Evans,D.G.
Journal Breast Cancer Res. Treat. 134 (2), 895-897 (2012)
Title Evaluation of RAD51C as cancer susceptibility gene in a large breast-ovarian cancer patient population referred for genetic testing .
Author De Leeneer,K., Van Bockstal,M., De Brouwer,S., Swietek,N., Schietecatte,P., Sabbaghian,N., Van den Ende,J., Willocx,S., Storm,K., Blaumeiser,B., Van Asperen,C.J., Wijnen,J.T., Leunen,K., Legius,E., Michils,G., Matthijs,G., Blok,M.J., Gomez-Garcia,E., De Paepe,A., Tischkowitz,M., Poppe,B. and Claes,K.
Journal Breast Cancer Res. Treat. 133 (1), 393-398 (2012)
Title Distinct roles of FANCO/RAD51C protein in DNA damage signaling and repair: implications for Fanconi anemia and breast cancer susceptibility .
Author Somyajit,K., Subramanya,S. and Nagaraju,G.
Journal J. Biol. Chem. 287 (5), 3366-3380 (2012)
Title 17q23 amplifications in breast cancer involve the PAT1, RAD51C, PS6K, and SIGma1B genes .
Author Wu,G.J., Sinclair,C.S., Paape,J., Ingle,J.N., Roche,P.C., James,C.D. and Couch,F.J.
Journal Cancer Res. 60 (19), 5371-5375 (2000)
Title Multiple genes at 17q23 undergo amplification and overexpression in breast cancer .
Author Barlund,M., Monni,O., Kononen,J., Cornelison,R., Torhorst,J., Sauter,G., Kallioniemi,O.L.L.I.-P. and Kallioniemi,A.
Journal Cancer Res. 60 (19), 5340-5344 (2000)
Title Gene encoding a new RING-B-box-Coiled-coil protein is mutated in mulibrey nanism .
Author Avela,K., Lipsanen-Nyman,M., Idanheimo,N., Seemanova,E., Rosengren,S., Makela,T.P., Perheentupa,J., Chapelle,A.D. and Lehesjoki,A.E.
Journal Nat. Genet. 25 (3), 298-301 (2000)
Title Evidence for simultaneous protein interactions between human Rad51 paralogs .
Author Schild,D., Lio,Y.C., Collins,D.W., Tsomondo,T. and Chen,D.J.
Journal J. Biol. Chem. 275 (22), 16443-16449 (2000)
Title Isolation and characterization of RAD51C, a new human member of the RAD51 family of related genes .
Author Dosanjh,M.K., Collins,D.W., Fan,W., Lennon,G.G., Albala,J.S., Shen,Z. and Schild,D.
Journal Nucleic Acids Res. 26 (5), 1179-1184 (1998)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.