• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens RAD51 paralog C (RAD51C), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu21400 Homo sapiens RAD51 paralog C (RAD51C), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu21400C Homo sapiens RAD51 paralog C (RAD51C), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_058216.2, 525313567
Length 1131 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens RAD51 paralog C (RAD51C), transcript variant 1, mRNA.
Product DNA repair protein RAD51 homolog 3 isoform 1
Comment

Summary: This gene is a member of the RAD51 family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51 and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with other RAD51 paralogs and is reported to be important for Holliday junction resolution. Mutations in this gene are associated with Fanconi anemia-like syndrome. This gene is one of four localized to a region of chromosome 17q23 where amplification occurs frequently in breast tumors. Overexpression of the four genes during amplification has been observed and suggests a possible role in tumor progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013].


Transcript Variant: This variant (1) is the longest transcript and encodes the longer isoform (1).

RefSeq NP_478123.1
CDS 72..1202
Misc Feature(1)72..449
Misc Feature(2)72..449
Misc Feature(3)96..242
Misc Feature(4)132..1115
Misc Feature(5)306..479
Misc Feature(6)369..1112
Misc Feature(7)444..467
Misc Feature(8)order(450..452,462..467,540..542,546..548,552..554,
Misc Feature(9)order(537..539,543..545,567..569,576..578,684..686,
Misc Feature(10)783..797
Misc Feature(11)1167..1181
Exon (1)1..216
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; R51H3; RAD51L2
Exon (2)217..475
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; R51H3; RAD51L2
Exon (3)476..642
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; R51H3; RAD51L2
Exon (4)643..776
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; R51H3; RAD51L2
Exon (5)777..908
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; R51H3; RAD51L2
Exon (6)909..975
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; R51H3; RAD51L2
Exon (7)976..1036
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; R51H3; RAD51L2
Exon (8)1037..1097
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; R51H3; RAD51L2
Exon (9)1098..1322
Gene:RAD51C
Gene Synonym:BROVCA3; FANCO; R51H3; RAD51L2
Translation MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALET LQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKT TEICGAPGVGKTQLCMQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHL QLIAEKHKGEEHRKALEDFTLDNILSHIYYFRCRDYTELLAQVYLLPDFLSEHSKVRLVI VDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKIDRNQALLVPA LGESWGHAATIRLIFHWDRKQRLATLYKSPSQKECTVLFQIKPQGFRDTVVTSACSLQTE GSLSTRKRSRDPEEEL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
18+dbSNP:
18+c, gdbSNP:28363298
19+c, tdbSNP:28363299
31+a, tdbSNP:373116323
43+c, tdbSNP:375603530
46+c, tdbSNP:12946397
48+a, cdbSNP:181444396
53+a, gdbSNP:375889604
78+a, gdbSNP:376403182
85+c, tdbSNP:201523760
105+c, tdbSNP:28910276
161+a, gdbSNP:115414895
206+c, gdbSNP:371608994
221+dbSNP:
221+g, tdbSNP:1127858
254+a, gdbSNP:200531489
257+a, gdbSNP:28363303
266+a, gdbSNP:45511291
271+a, gdbSNP:375451955
304+c, tdbSNP:112832782
320+c, gdbSNP:145387081
329+a, tdbSNP:149228565
359+c, gdbSNP:143180709
406+c, gdbSNP:370212314
422+a, gdbSNP:370986989
444+a, gdbSNP:142058115
445+g, tdbSNP:267606998
447+a, gdbSNP:61758784
468+c, tdbSNP:387907159
485+dbSNP:
485+c, gdbSNP:267606999
493+a, gdbSNP:376494695
502+c, tdbSNP:28363307
524+a, gdbSNP:45553636
537..538+, gtttdbSNP:143941948
556+a, gdbSNP:35151472
584+c, tdbSNP:140279158
608+c, tdbSNP:372385738
648+dbSNP:
648+c, tdbSNP:200293302
705+c, tdbSNP:137947462
706+a, gdbSNP:200857129
711+c, tdbSNP:140804406
727+c, tdbSNP:201529791
781+dbSNP:
781+a, gdbSNP:370393672
792+a, gdbSNP:184033132
800+g, tdbSNP:371232381
801+a, gdbSNP:199886026
815+c, tdbSNP:150142859
816+c, tdbSNP:28363311
844+a, gdbSNP:267606997
849+c, tdbSNP:374196453
854+a, gdbSNP:138643096
855+g, tdbSNP:149331537
861+a, gdbSNP:147241704
884+c, tdbSNP:376853755
930+dbSNP:
930+a, gdbSNP:28363317
941+a, tdbSNP:376402418
959+a, gdbSNP:370829773
961+c, tdbSNP:143026267
993+dbSNP:
993+g, tdbSNP:185057307
1016+c, tdbSNP:201235884
1027+a, gdbSNP:367846829
1114+dbSNP:
1114+a, gdbSNP:111614311
1120+g, tdbSNP:148537339
1133+a, gdbSNP:201000407
1180+a, gdbSNP:373170458
1200+c, tdbSNP:377262060
1227+c, gdbSNP:28363336
1233+c, tdbSNP:374605909
1242+c, tdbSNP:181365564
Gene SymbolRAD51C
Gene SynonymBROVCA3; FANCO; R51H3; RAD51L2
Chromosome17
Locus Map17q22
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_058216 Homo sapiens RAD51 paralog C (RAD51C), transcript variant 1, mRNA. In-stock $99.00 5-7
NM_058216 Homo sapiens RAD51 paralog C (RAD51C), transcript variant 1, mRNA. In-stock $99.00 5-7
NM_058216 Homo sapiens RAD51 paralog C (RAD51C), transcript variant 1, mRNA. In-stock $99.00 5-7
NM_058216 Homo sapiens RAD51 paralog C (RAD51C), transcript variant 1, mRNA. In-stock $99.00 5-7
NM_058216 Homo sapiens RAD51 paralog C (RAD51C), transcript variant 1, mRNA. In-stock $99.00 5-7
NM_058216 Homo sapiens RAD51 paralog C (RAD51C), transcript variant 1, mRNA. In-stock $99.00 5-7
NM_058216 Homo sapiens RAD51 paralog C (RAD51C), transcript variant 1, mRNA. In-stock $99.00 5-7
NM_058216 Homo sapiens RAD51 paralog C (RAD51C), transcript variant 1, mRNA. In-stock $99.00 5-7
Title Genome-wide association study of primary tooth eruption identifies pleiotropic loci associated with height and craniofacial distances .
Author Fatemifar G, Hoggart CJ, Paternoster L, Kemp JP, Prokopenko I, Horikoshi M, Wright VJ, Tobias JH, Richmond S, Zhurov AI, Toma AM, Pouta A, Taanila A, Sipila K, Lahdesmaki R, Pillas D, Geller F, Feenstra B, Melbye M, Nohr EA, Ring SM, St Pourcain B, Timpson NJ, Davey Smith G, Jarvelin MR and Evans DM.
Journal Hum. Mol. Genet. 22 (18), 3807-3817 (2013)
Title The HsRAD51B-HsRAD51C stabilizes the HsRAD51 nucleoprotein filament .
Author Amunugama R, Groden J and Fishel R.
Journal DNA Repair (Amst.) 12 (9), 723-732 (2013)
Title Mutation of the RAD51C gene in a Fanconi anemia-like disorder .
Author Vaz F, Hanenberg H, Schuster B, Barker K, Wiek C, Erven V, Neveling K, Endt D, Kesterton I, Autore F, Fraternali F, Freund M, Hartmann L, Grimwade D, Roberts RG, Schaal H, Mohammed S, Rahman N, Schindler D and Mathew CG.
Journal Nat. Genet. 42 (5), 406-409 (2010)
Title RAD51C is required for Holliday junction processing in mammalian cells .
Author Liu Y, Masson JY, Shah R, O'Regan P and West SC.
Journal Science 303 (5655), 243-246 (2004)
Title Homologous-pairing activity of the human DNA-repair proteins Xrcc3.Rad51C .
Author Kurumizaka H, Ikawa S, Nakada M, Eda K, Kagawa W, Takata M, Takeda S, Yokoyama S and Shibata T.
Journal Proc. Natl. Acad. Sci. U.S.A. 98 (10), 5538-5543 (2001)
Title 17q23 amplifications in breast cancer involve the PAT1, RAD51C, PS6K, and SIGma1B genes .
Author Wu GJ, Sinclair CS, Paape J, Ingle JN, Roche PC, James CD and Couch FJ.
Journal Cancer Res. 60 (19), 5371-5375 (2000)
Title Multiple genes at 17q23 undergo amplification and overexpression in breast cancer .
Author Barlund M, Monni O, Kononen J, Cornelison R, Torhorst J, Sauter G, Kallioniemi OLLI-P and Kallioniemi A.
Journal Cancer Res. 60 (19), 5340-5344 (2000)
Title Evidence for simultaneous protein interactions between human Rad51 paralogs .
Author Schild D, Lio YC, Collins DW, Tsomondo T and Chen DJ.
Journal J. Biol. Chem. 275 (22), 16443-16449 (2000)
Title Isolation and characterization of RAD51C, a new human member of the RAD51 family of related genes .
Author Dosanjh MK, Collins DW, Fan W, Lennon GG, Albala JS, Shen Z and Schild D.
Journal Nucleic Acids Res. 26 (5), 1179-1184 (1998)
Title Fanconi Anemia .
Author Alter,B.P. and Kupfer,G.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.