|
You are here:
Biology CRO for Drug Discovery » Molecular Biology Services » Custom ORF Cloning Services » ORF Detail
 |
Caenorhabditis elegans CPEB polyA binding family member (cpb-1) (cpb-1) mRNA, complete cds.
| RefSeq Version | NM_066650.4, 193205588 |
| Length | 2290 bp |
| Structure | linear |
| Update Date | 13-NOV-2008 |
| Organism | Caenorhabditis elegans |
| Definition | Caenorhabditis elegans CPEB polyA binding family member (cpb-1) (cpb-1) mRNA, complete cds. |
| Product | CPEB polyA binding family member (cpb-1) |
| Comment | COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. The reference sequence was derived from C40H1.1. On Jun 27, 2008 this sequence version replaced gi:133905253. Expression: cpb-1 encodes a cytoplasmic polyadenylation element binding (CPEB) protein homolog involved in two steps of spermatogenesis; two CPEB proteins have distinct functions in spermatogenesis, with FOG-1 specifying sperm cell fate, and CPB-1 conversely executing that decision, being required for progression through meiosis; cpb-1(RNAi) spermatocytes fail to undergo meiotic cell divisions; CPB-1 protein is present in the germ line just prior to overt spermatogenesis, but once sperm differentiation begins, CPB-1 disappears; CPB-1 physically interacts with EBF, which, like CPEB, regulates genes by binding the 3' UTRs of mRNAs; while CPB-1 is required for spermatogenesis, it is dispensable for oogenesis; this is in contrast to CPEBs in vertebrates (Xenopus), arthropods (Drosophila), and molluscs (Spisula), which all participate in oogenesis. RNAi results: [Sonnichsen B] Not abnormal based on scoring phenotypes embryonic_lethal, organism_morphology_abnormal, maternal_sterile. [Kamath RS] Not abnormal based on scoring phenotypes slow_growth, postembryonic_development_abnormal, embryonic_lethal, larval_lethal, larval_arrest, maternal_sterile, sterile_progeny. [Gonczy P] Not abnormal based on scoring phenotypes postembryonic_development_abnormal, embryonic_development_abnormal. [Rual JF] Not abnormal based on scoring phenotypes postembryonic_development_abnormal, lethal. [Boag PR] Abnormal; the following phenotypes were observed: reduced_brood_size, unclassified. [Luitjens CM] Abnormal; the following phenotypes were observed: spermatocyte_meiosis_abnormal. [Maeda I] Not abnormal based on scoring phenotypes embryonic_lethal, lethal, organism_morphology_abnormal, maternal_sterile. Expression patterns: CPB-1 protein was detected at high levels in the L4 germ line, in a region just distal to the region that stained by SP56. An identical distribution was observed in males. |
| RefSeq | NP_499051.2 |
| CDS | 1..1680 |
| Translation | MQYQLSPSGDFKTSAPVRSSHGHRRSTESKKSGGHGNPYLSTDKTNLDISVSFLTSQAQK
KMRGMSANHGIFDPTEMLTADDPSNYGYQFLNHATFYNNMDIMQAASGDVPPLMSVNPYK
QSFDINDASAAMNMAQFAHTLNAIQNSSYSMSHYNQAPMQHFISPNSFHVSYNQRFPHIK
KCNDANRMVEIKKINGHRYMEVTDPQAVSAPPEYKRLDGSLMGVSKSCLEASKKRPISAE
PLYSRKVFIGGLPIDVSEEQVWATFGAFGKVLIDWPRRPEHNAERAEQELKKGSGSRAVT
GYVFLVFTHERSVQELVNACEFYEDKYYLQLSSPTMTDKAVQVRPWRLSDIDYFCNDNSS
VDHRRTVFIGGVPRPTRAQDLARCLEGHYGKVSYVGIDIDPELKYPKGAARVTFSTSQAF
VRAISGRFVQVNHAENNKRVEIKPYVMEEQYCDECEGRLCKHNYAPYFCGHASCLQYYCE
GCWDRMHIGKNEDNKLEDQHYPMVRTGDQTRLLKHLPHRSSGFKPAPVFHPSSQSTTAKI
LAYGDQSQRQFSATPSYSF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| Title | Direct Submission . |
| Author | |
| Journal | Submitted (11-AUG-2003) Nematode Sequencing Project, Wellcome Trust Sanger Institute, Hinxton, Cambridge CB10 1SA, UK, and Genome Sequencing Center, Washington University, St. Louis, MO 63110, USA. E-mail: sequence@wormbase.org |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |