• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f, mRNA.


RefSeq Accession Definition Services Price Order
NM_079422 Homo sapiens myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f, mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_079422.2, 115527083
Length 862 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f, mRNA.
Product myosin light chain 1/3, skeletal muscle isoform isoform 3f
Comment

Summary: Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (3f) encodes a protein that is 44 aa shorter than isoform 1f. Transcript variants 3f and 1f differ in their first two exons.

RefSeq NP_524146.1
CDS 72..524
Misc Feature(1)81..518
Misc Feature(2)81..518
Misc Feature(3)99..293
Misc Feature(4)order(126..128,132..134,138..140,159..161,240..242,
Misc Feature(5)330..515
Misc Feature(6)order(357..359,363..365,369..371,390..392,462..464,
Exon (1)1..74
Gene:MYL1
Gene Synonym:MLC1F; MLC3F
Exon (2)75..99
Gene:MYL1
Gene Synonym:MLC1F; MLC3F
Exon (3)100..243
Gene:MYL1
Gene Synonym:MLC1F; MLC3F
Exon (4)244..417
Gene:MYL1
Gene Synonym:MLC1F; MLC3F
Exon (5)418..495
Gene:MYL1
Gene Synonym:MLC1F; MLC3F
Exon (6)496..538
Gene:MYL1
Gene Synonym:MLC1F; MLC3F
Exon (7)539..862
Gene:MYL1
Gene Synonym:MLC1F; MLC3F
Translation MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELN AKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMK EEEVEALMAGQEDSNGCINYEAFVKHIMSI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(11)-dbSNP:
complement(11)-g, adbSNP:144118989
complement(63)-g, adbSNP:181132123
complement(64)-t, cdbSNP:200303195
complement(73)-g, adbSNP:138512142
complement(79)-dbSNP:
complement(79)-c, adbSNP:149277744
complement(89)-t, gdbSNP:184563845
complement(107)-dbSNP:
complement(107)-c, adbSNP:138478671
complement(122)-g, cdbSNP:1135254
complement(135)-g, adbSNP:11554011
complement(150)-t, adbSNP:145897731
complement(165)-t, cdbSNP:199843326
complement(170)-g, adbSNP:143274393
complement(174)-g, adbSNP:145275381
complement(178)-t, cdbSNP:141590730
complement(182)-t, cdbSNP:1057219
complement(203)-g, adbSNP:145306902
complement(206)-g, adbSNP:11554008
complement(323)-dbSNP:
complement(323)-t, gdbSNP:139637576
complement(325)-t, cdbSNP:116054444
complement(341)-t, cdbSNP:149445418
complement(348)-g, adbSNP:146383845
complement(349)-t, cdbSNP:139030210
complement(397)-t, cdbSNP:150240747
complement(446)-dbSNP:
complement(446)-t, cdbSNP:143710089
complement(509)-dbSNP:
complement(509)-g, adbSNP:200558852
complement(593)-c, adbSNP:11554010
complement(645)-t, cdbSNP:181484899
complement(666)-t, cdbSNP:1803984
complement(680)-t, cdbSNP:191693602
complement(741)-t, adbSNP:186770286
Gene SymbolMYL1
Gene SynonymMLC1F; MLC3F
Chromosome2
Locus Map2q33-q34
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_079420 Homo sapiens myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 1f, mRNA. Full Length $305.08
ORF Sequence $169.65
NM_079422 Homo sapiens myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f, mRNA. Full Length $249.98
ORF Sequence $159.00
Title The MLK-related kinase (MRK) is a novel RhoC effector that mediates lysophosphatidic acid (LPA)-stimulated tumor cell invasion .
Author Korkina,O., Dong,Z., Marullo,A., Warshaw,G., Symons,M. and Ruggieri,R.
Journal J. Biol. Chem. 288 (8), 5364-5373 (2013)
Title Mutations of ventricular essential myosin light chain disturb myosin binding and sarcomeric sorting .
Author Lossie,J., Ushakov,D.S., Ferenczi,M.A., Werner,S., Keller,S., Haase,H. and Morano,I.
Journal Cardiovasc. Res. 93 (3), 390-396 (2012)
Title Ischemia induced peroxynitrite dependent modifications of cardiomyocyte MLC1 increases its degradation by MMP-2 leading to contractile dysfunction .
Author Polewicz,D., Cadete,V.J., Doroszko,A., Hunter,B.E., Sawicka,J., Szczesna-Cordary,D., Light,P.E. and Sawicki,G.
Journal J. Cell. Mol. Med. 15 (5), 1136-1147 (2011)
Title Inhibition of MLC phosphorylation restricts replication of influenza virus--a mechanism of action for anti-influenza agents .
Author Haidari,M., Zhang,W., Ganjehei,L., Ali,M. and Chen,Z.
Journal PLoS ONE 6 (6), E21444 (2011)
Title Interaction of ADP-ribosylated actin with actin binding proteins .
Author Ballweber,E., Galla,M., Aktories,K., Yeoh,S., Weeds,A.G. and Mannherz,H.G.
Journal FEBS Lett. 508 (1), 131-135 (2001)
Title Characterization of human myosin light chains 1sa and 3nm: implications for isoform evolution and function .
Author Hailstones,D.L. and Gunning,P.W.
Journal Mol. Cell. Biol. 10 (3), 1095-1104 (1990)
Title Identification of the functional promoter regions in the human gene encoding the myosin alkali light chains MLC1 and MLC3 of fast skeletal muscle .
Author Seidel,U. and Arnold,H.H.
Journal J. Biol. Chem. 264 (27), 16109-16117 (1989)
Title Alkali myosin light chains in man are encoded by a multigene family that includes the adult skeletal muscle, the embryonic or atrial, and nonsarcomeric isoforms .
Author Seidel,U., Bober,E., Winter,B., Lenz,S., Lohse,P., Goedde,H.W., Grzeschik,K.H. and Arnold,H.H.
Journal Gene 66 (1), 135-146 (1988)
Title Assignment of the human fast skeletal muscle myosin alkali light chains gene (MLC1F/MLC3F) to 2q 32.1-2qter .
Author Cohen-Haguenauer,O., Barton,P.J., Nguyen,V.C., Serero,S., Gross,M.S., Jegou-Foubert,C., de Tand,M.F., Robert,B., Buckingham,M. and Frezal,J.
Journal Hum. Genet. 78 (1), 65-70 (1988)
Title The complete nucleotide sequences of cDNA clones coding for human myosin light chains 1 and 3 .
Author Seidel,U., Bober,E., Winter,B., Lenz,S., Lohse,P. and Arnold,H.H.
Journal Nucleic Acids Res. 15 (12), 4989 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878