• THAT   AND
  • THAT   AND


Homo sapiens myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f, mRNA.


RefSeq Accession Definition Sequence Price Select
NM_079422 Homo sapiens myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f, mRNA. Full Lenth $249.98
ORF Sequence $159.00


RefSeq Version NM_079422.2, 115527083
Length 862 bp
Structure linear
Update Date 19-FEB-2011
Organism Homo sapiens (human)
Definition Homo sapiens myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f, mRNA.
Product myosin light chain 1/3, skeletal muscle isoform isoform 3f
Comment

Summary: Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. [provided by RefSeq].


Transcript Variant: This variant (3f) encodes a protein that is 44 aa shorter than isoform 1f. Transcript variants 3f and 1f differ in their first two exons. COMPLETENESS: full length.

RefSeq NP_524146.1
CDS 72..524
Exon (1)1..74
Exon (2)1..74
Exon (3)75..99
Exon (4)100..243
Exon (5)244..417
Exon (6)418..495
Exon (7)496..538
Exon (8)539..862
Translation MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELN AKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMK EEEVEALMAGQEDSNGCINYEAFVKHIMSI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(40)-g, adbSNP:75479138
122+c, gdbSNP:1135254
135+a, gdbSNP:11554011
182+c, tdbSNP:1057219
206+a, gdbSNP:11554008
complement(325)-t, cdbSNP:116054444
593+a, cdbSNP:11554010
666+c, tdbSNP:1803984
Gene SymbolMYL1
Gene SynonymMLC1F; MLC3F
Chromosome2
Locus Map2q33-q34
All Transcripts NM_079422 , NM_079420
Title Interaction of ADP-ribosylated actin with actin binding proteins .
Author Ballweber,E., Galla,M., Aktories,K., Yeoh,S., Weeds,A.G. and Mannherz,H.G.
Journal FEBS Lett. 508 (1), 131-135 (2001)
Title A nonerythroid isoform of protein 4.1R interacts with components of the contractile apparatus in skeletal myofibers .
Author Kontrogianni-Konstantopoulos,A., Huang,S.C. and Benz,E.J. Jr.
Journal Mol. Biol. Cell 11 (11), 3805-3817 (2000)
Title Modular regulation of the MLC1F/3F gene and striated muscle diversity .
Author Kelly,R.G. and Buckingham,M.E.
Journal Microsc. Res. Tech. 50 (6), 510-521 (2000)
Title Maximum velocity of shortening in relation to myosin isoform composition in single fibres from human skeletal muscles .
Author Larsson,L. and Moss,R.L.
Journal J. Physiol. (Lond.) 472, 595-614 (1993)
Title Characterization of human myosin light chains 1sa and 3nm: implications for isoform evolution and function .
Author Hailstones,D.L. and Gunning,P.W.
Journal Mol. Cell. Biol. 10 (3), 1095-1104 (1990)
Title Identification of the functional promoter regions in the human gene encoding the myosin alkali light chains MLC1 and MLC3 of fast skeletal muscle .
Author Seidel,U. and Arnold,H.H.
Journal J. Biol. Chem. 264 (27), 16109-16117 (1989)
Title Alkali myosin light chains in man are encoded by a multigene family that includes the adult skeletal muscle, the embryonic or atrial, and nonsarcomeric isoforms .
Author Seidel,U., Bober,E., Winter,B., Lenz,S., Lohse,P., Goedde,H.W., Grzeschik,K.H. and Arnold,H.H.
Journal Gene 66 (1), 135-146 (1988)
Title Assignment of the human fast skeletal muscle myosin alkali light chains gene (MLC1F/MLC3F) to 2q 32.1-2qter .
Author Cohen-Haguenauer,O., Barton,P.J., Nguyen,V.C., Serero,S., Gross,M.S., Jegou-Foubert,C., de Tand,M.F., Robert,B., Buckingham,M. and Frezal,J.
Journal Hum. Genet. 78 (1), 65-70 (1988)
Title The complete nucleotide sequences of cDNA clones coding for human myosin light chains 1 and 3 .
Author Seidel,U., Bober,E., Winter,B., Lenz,S., Lohse,P. and Arnold,H.H.
Journal Nucleic Acids Res. 15 (12), 4989 (1987)
Title The myosin alkali light chain proteins and their genes .
Author Barton,P.J. and Buckingham,M.E.
Journal Biochem. J. 231 (2), 249-261 (1985)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878