• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu13487 Homo sapiens myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu13487C Homo sapiens myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_079422.2, 115527083
Length 453 bp
Structure linear
Update Date 23-MAR-2014
Organism Homo sapiens (human)
Definition Homo sapiens myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f, mRNA.
Product myosin light chain 1/3, skeletal muscle isoform isoform 3f
Comment

Summary: Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (3f) encodes a protein that is 44 aa shorter than isoform 1f. Transcript variants 3f and 1f differ in their first two exons.

RefSeq NP_524146.1
CDS 72..524
Misc Feature(1)81..518
Misc Feature(2)81..518
Misc Feature(3)99..293
Misc Feature(4)order(126..128,132..134,138..140,159..161,228..230,
Misc Feature(5)330..515
Misc Feature(6)order(357..359,363..365,369..371,390..392,462..464,
Exon (1)1..74
Gene:MYL1
Gene Synonym:MLC1F; MLC3F
Exon (2)75..99
Gene:MYL1
Gene Synonym:MLC1F; MLC3F
Exon (3)100..243
Gene:MYL1
Gene Synonym:MLC1F; MLC3F
Exon (4)244..417
Gene:MYL1
Gene Synonym:MLC1F; MLC3F
Exon (5)418..495
Gene:MYL1
Gene Synonym:MLC1F; MLC3F
Exon (6)496..538
Gene:MYL1
Gene Synonym:MLC1F; MLC3F
Exon (7)539..862
Gene:MYL1
Gene Synonym:MLC1F; MLC3F
Translation MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELN AKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMK EEEVEALMAGQEDSNGCINYEAFVKHIMSI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(11)-dbSNP:
complement(11)-g, adbSNP:144118989
complement(63)-g, adbSNP:181132123
complement(64)-t, cdbSNP:200303195
complement(73)-g, adbSNP:138512142
complement(79)-dbSNP:
complement(79)-c, adbSNP:149277744
complement(89)-t, gdbSNP:184563845
complement(107)-dbSNP:
complement(107)-c, adbSNP:138478671
122+c, gdbSNP:1135254
135+a, gdbSNP:11554011
complement(150)-t, adbSNP:145897731
complement(165)-t, cdbSNP:199843326
complement(170)-g, adbSNP:143274393
complement(174)-g, adbSNP:145275381
complement(178)-t, cdbSNP:141590730
182+c, tdbSNP:1057219
complement(203)-g, adbSNP:145306902
206+a, gdbSNP:11554008
complement(268)-dbSNP:
complement(268)-g, adbSNP:371995777
complement(306)-t, cdbSNP:367816223
complement(323)-t, gdbSNP:139637576
complement(325)-t, cdbSNP:116054444
complement(341)-t, cdbSNP:149445418
complement(348)-g, adbSNP:146383845
complement(349)-t, cdbSNP:139030210
complement(387)-t, cdbSNP:374842955
complement(396)-g, adbSNP:370058858
complement(397)-t, cdbSNP:150240747
complement(413)-t, gdbSNP:377511663
complement(446)-dbSNP:
complement(446)-t, cdbSNP:143710089
complement(509)-dbSNP:
complement(509)-g, adbSNP:200558852
complement(516)-t, adbSNP:372225011
complement(533)-g, adbSNP:369883035
593+a, cdbSNP:11554010
complement(645)-t, cdbSNP:181484899
666+c, tdbSNP:1803984
complement(680)-t, cdbSNP:191693602
complement(741)-t, adbSNP:186770286
Gene SymbolMYL1
Gene SynonymMLC1F; MLC3F
Chromosome2
Locus Map2q33-q34
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_079422 Homo sapiens myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f, mRNA. In-stock $99.00 5-7
NM_079422 Homo sapiens myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f, mRNA. In-stock $99.00 5-7
Title The MLK-related kinase (MRK) is a novel RhoC effector that mediates lysophosphatidic acid (LPA)-stimulated tumor cell invasion .
Author Korkina O, Dong Z, Marullo A, Warshaw G, Symons M and Ruggieri R.
Journal J. Biol. Chem. 288 (8), 5364-5373 (2013)
Title Mutations of ventricular essential myosin light chain disturb myosin binding and sarcomeric sorting .
Author Lossie J, Ushakov DS, Ferenczi MA, Werner S, Keller S, Haase H and Morano I.
Journal Cardiovasc. Res. 93 (3), 390-396 (2012)
Title Ischemia induced peroxynitrite dependent modifications of cardiomyocyte MLC1 increases its degradation by MMP-2 leading to contractile dysfunction .
Author Polewicz D, Cadete VJ, Doroszko A, Hunter BE, Sawicka J, Szczesna-Cordary D, Light PE and Sawicki G.
Journal J. Cell. Mol. Med. 15 (5), 1136-1147 (2011)
Title Inhibition of MLC phosphorylation restricts replication of influenza virus--a mechanism of action for anti-influenza agents .
Author Haidari M, Zhang W, Ganjehei L, Ali M and Chen Z.
Journal PLoS ONE 6 (6), E21444 (2011)
Title Interaction of ADP-ribosylated actin with actin binding proteins .
Author Ballweber E, Galla M, Aktories K, Yeoh S, Weeds AG and Mannherz HG.
Journal FEBS Lett. 508 (1), 131-135 (2001)
Title Characterization of human myosin light chains 1sa and 3nm: implications for isoform evolution and function .
Author Hailstones DL and Gunning PW.
Journal Mol. Cell. Biol. 10 (3), 1095-1104 (1990)
Title Identification of the functional promoter regions in the human gene encoding the myosin alkali light chains MLC1 and MLC3 of fast skeletal muscle .
Author Seidel U and Arnold HH.
Journal J. Biol. Chem. 264 (27), 16109-16117 (1989)
Title Alkali myosin light chains in man are encoded by a multigene family that includes the adult skeletal muscle, the embryonic or atrial, and nonsarcomeric isoforms .
Author Seidel U, Bober E, Winter B, Lenz S, Lohse P, Goedde HW, Grzeschik
Journal Gene 66 (1), 135-146 (1988)
Title Assignment of the human fast skeletal muscle myosin alkali light chains gene (MLC1F/MLC3F) to 2q 32.1-2qter .
Author Cohen-Haguenauer O, Barton PJ, Nguyen VC, Serero S, Gross MS, Jegou-Foubert C, de Tand MF, Robert B, Buckingham M and Frezal J.
Journal Hum. Genet. 78 (1), 65-70 (1988)
Title The complete nucleotide sequences of cDNA clones coding for human myosin light chains 1 and 3 .
Author Seidel,U., Bober,E., Winter,B., Lenz,S., Lohse,P. and Arnold,H.H.
Journal Nucleic Acids Res. 15 (12), 4989 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.